Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_011382581.1 AMB_RS00675 KR domain-containing protein
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000009985.1:WP_011382581.1 Length = 238 Score = 95.5 bits (236), Expect = 9e-25 Identities = 82/262 (31%), Positives = 121/262 (46%), Gaps = 28/262 (10%) Query: 6 NLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDISSASE 65 +L K+ VTGG GIG AI LLA GA V + G + + Y D + A+ Sbjct: 3 SLAGKLALVTGGTRGIGAAIAARLLADGAKVMVTGTRPGGEGPAGSGY--LAVDFADAAA 60 Query: 66 VHKTVDHIIQRFGR-IDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKGVF 124 T Q G +D LVNNAG+N S E++ A F ++ +N F Sbjct: 61 ---TTAFAEQAAGLGVDILVNNAGIN---------KVSPFAEIDPADFARIQQVNVTAPF 108 Query: 125 LMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHGIR 184 L+++AV M + G IV VSS G G+ Y+A+K A++ T + + E+ + GI Sbjct: 109 LLARAVVPGMQAKAWGRIVTVSSIWGRISRAGRGAYSASKFAVDGLTAALAAEVAQFGIL 168 Query: 185 VVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVADFVCY 244 VAPG ++ R E+ + + +T + +P R GR E+A FV + Sbjct: 169 ANCVAPGFIDTELTRQVLGEDGI---KELTAQ----------VPARRLGRPEEIAAFVAW 215 Query: 245 LLSERASYMTGVTTNIAGGKTR 266 L SY++G I GG TR Sbjct: 216 LAGPENSYISGQNLVIDGGFTR 237 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 238 Length adjustment: 24 Effective length of query: 243 Effective length of database: 214 Effective search space: 52002 Effective search space used: 52002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory