Align Sorbitol-6-phosphate 2-dehydrogenase; EC 1.1.1.140; Glucitol-6-phosphate dehydrogenase; Ketosephosphate reductase (uncharacterized)
to candidate WP_011384506.1 AMB_RS10625 3-oxoacyl-[acyl-carrier-protein] reductase
Query= curated2:P37079 (267 letters) >lcl|NCBI__GCF_000009985.1:WP_011384506.1 AMB_RS10625 3-oxoacyl-[acyl-carrier-protein] reductase Length = 245 Score = 105 bits (263), Expect = 7e-28 Identities = 79/265 (29%), Positives = 128/265 (48%), Gaps = 33/265 (12%) Query: 6 NLKDNVIIVTGGASGIGLAIVDELLSQGAHVQMIDIHGGDRH-------HNGDNYHFWST 58 +L +VTG + GIG AI L ++GA V +HG R G+ H Sbjct: 3 DLTGKTALVTGASGGIGGAIAKALHARGATV---GLHGTRREALDALAAELGERVHVLPA 59 Query: 59 DISSATEVQQTIDAIIQRWSRIDGLVNNAGVNFPRLLVDEKAPAGRYELNEAAFEKMVNI 118 ++S A V+Q +D LVNNAG+ L++ + + ++ ++++ Sbjct: 60 NLSDAAAVEQLAKDAEAAMGSVDILVNNAGLTKDGLVL---------RMKDEDWQTVLDV 110 Query: 119 NQKGVFFMSQAVARQMVKQRAGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKEL 178 N F +S+A + +K+R G I+N++S G+ G+ GQ YAA+KA + +++ ++E+ Sbjct: 111 NLTAAFRLSRAAVKGQMKRRWGRIINITSIVGVTGNPGQVNYAASKAGMIGMSKALAQEV 170 Query: 179 GKYGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYTKNAIPIGRAGKLSEV 238 I V VAPG + A T ++ EQ + IP GR G E+ Sbjct: 171 ASRNITVNCVAPGFVSS------------AMTDVLSDEQKTK--LNAGIPAGRMGTADEI 216 Query: 239 ADFVCYLLSARASYITGVTTNIAGG 263 A V YL SA A+Y+TG T ++ GG Sbjct: 217 AAAVVYLASAEAAYVTGQTLHVNGG 241 Lambda K H 0.316 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 245 Length adjustment: 24 Effective length of query: 243 Effective length of database: 221 Effective search space: 53703 Effective search space used: 53703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory