Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate WP_011382532.1 AMB_RS00430 CBS domain-containing protein
Query= BRENDA::P74285 (388 letters) >NCBI__GCF_000009985.1:WP_011382532.1 Length = 349 Score = 118 bits (296), Expect = 2e-31 Identities = 71/238 (29%), Positives = 127/238 (53%), Gaps = 20/238 (8%) Query: 4 MILAAGKGTRVRPITHTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSHLAEEIESY 63 +++A G+G R+RP+T +PKP++P+ +P++E +L+ + GF ++V++ AE++ES+ Sbjct: 123 VLMAGGEGRRLRPLTQDVPKPLLPVGPRPILETILKNFIEAGFRNFFISVNYRAEQVESH 182 Query: 64 FRDGQRFGVQIAYSFEGNIVDGDLVGKALGSAGGLKKIQEFNPFFDDTFVVLCGDALIDL 123 F DG GV I Y E + LG+AG L + + +V+ GD L + Sbjct: 183 FGDGSALGVSIRYLRE---------DRQLGTAGALGLLPGTP---SEPLIVMNGDILTTV 230 Query: 124 DLTTAVKLHREKGAIATIITKTVPQELVSSYGVVVTDDNGKILTFQEKPAVEEALSTEIN 183 D + H+E A AT+ + E+ YGVV + ++ +EKP V +N Sbjct: 231 DFKQLLAFHQEHRAAATMAVREYHFEV--PYGVVEVEGT-RLKGIEEKPVVRNF----VN 283 Query: 184 TGIYIFEPEVIDYIPSGQEYDLGGDLFPKLVDSGLPFYAVNMDFEWVDIGKVPDYWQA 241 GIY+ PEV++ + GQ +++ ++ L+D G + W+DIG++ D+ +A Sbjct: 284 AGIYVLNPEVLNLVKPGQPHNM-PQIYQTLMDGGQDCAVFPIREYWLDIGRLDDFDRA 340 Lambda K H 0.321 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 349 Length adjustment: 30 Effective length of query: 358 Effective length of database: 319 Effective search space: 114202 Effective search space used: 114202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory