Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate WP_011383020.1 AMB_RS02985 UTP--glucose-1-phosphate uridylyltransferase
Query= BRENDA::Q8PK83 (297 letters) >NCBI__GCF_000009985.1:WP_011383020.1 Length = 291 Score = 293 bits (749), Expect = 4e-84 Identities = 147/286 (51%), Positives = 199/286 (69%), Gaps = 1/286 (0%) Query: 1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR 60 M++R+RKAVFPV G+GTRFLPATK +PKEMLP++DKPLIQYAV+EA AGC+ IFVT R Sbjct: 1 MTRRVRKAVFPVGGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAAAAGCEHFIFVTGR 60 Query: 61 YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAK 120 K+++ D+FD ELE+ L+ GK + +E V +P + + Q+E LGLGHAV CA+ Sbjct: 61 GKNALEDHFDHNPELERILKDRGKFDLVEAVTSWMPKSGQISYTRQSEPLGLGHAVWCAR 120 Query: 121 AVVGNEPFAVLLPDDLMWNRGDAALTQMANVAEASGGSVIAVEDVPHDKTASYGIVSTDA 180 +V +EPFAVLLPDDL+ ++ A L QMA V GG V+AV DVP + T YGI+ + Sbjct: 121 DLVADEPFAVLLPDDLILSK-TACLKQMAAVHTEVGGHVVAVSDVPREHTKRYGILDVEH 179 Query: 181 FDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAEL 240 +GR R +VEKP P+VAPS L+++GRY+L P +FD+L+ GAGGEIQLTDAI++ Sbjct: 180 DNGRLARAKGLVEKPDPDVAPSTLSIIGRYILHPAVFDVLDKKEKGAGGEIQLTDAISQT 239 Query: 241 LKEEQVDAFRFEGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEIL 286 + RFEG RFDCG +G +EA + FAL + A++++ Sbjct: 240 IGMVPFHGLRFEGNRFDCGDKVGWLEANLAFALARDDTAEAARDLI 285 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 291 Length adjustment: 26 Effective length of query: 271 Effective length of database: 265 Effective search space: 71815 Effective search space used: 71815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_011383020.1 AMB_RS02985 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.10384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-106 341.8 0.0 1.6e-106 341.6 0.0 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011383020.1 AMB_RS02985 UTP--glucose-1-phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011383020.1 AMB_RS02985 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 341.6 0.0 1.6e-106 1.6e-106 1 261 [] 5 266 .. 5 266 .. 0.99 Alignments for each domain: == domain 1 score: 341.6 bits; conditional E-value: 1.6e-106 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsy 69 +rkav+P+ G+Gtr+LPatka+Pkemlp+vdkPliqy+veea +aG+e+ ++vtgr+k+a+edhfD++ lcl|NCBI__GCF_000009985.1:WP_011383020.1 5 VRKAVFPVGGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAAAAGCEHFIFVTGRGKNALEDHFDHNP 73 79******************************************************************* PP TIGR01099 70 eleaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee 137 ele+ l++++k +l + v + +++ +i y+rq e GLGhav++a++lv+depfavll+Ddl+ ++++ lcl|NCBI__GCF_000009985.1:WP_011383020.1 74 ELERILKDRGKFDLVEAVTSWMPKsGQISYTRQSEPLGLGHAVWCARDLVADEPFAVLLPDDLILSKTA 142 ********************999879******************************************* PP TIGR01099 138 alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvl 206 +lkq+ ++++++g +++av++vp+e++++YG++d+e+ + +l + k lvekP+p+ aps l i+GrY+l lcl|NCBI__GCF_000009985.1:WP_011383020.1 143 CLKQMAAVHTEVGGHVVAVSDVPREHTKRYGILDVEHDNGRLARAKGLVEKPDPDVAPSTLSIIGRYIL 211 ********************************************************************* PP TIGR01099 207 tpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgylka 261 +p++f++l++ ++G+ggeiqltDa+++++ +++ +++g+r+D+Gdk+g+l+a lcl|NCBI__GCF_000009985.1:WP_011383020.1 212 HPAVFDVLDKKEKGAGGEIQLTDAISQTIGMVPFHGLRFEGNRFDCGDKVGWLEA 266 *****************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.51 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory