Align ABC transporter (characterized, see rationale)
to candidate WP_011385763.1 AMB_RS17210 molybdenum import ATP-binding protein ModC
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_000009985.1:WP_011385763.1 Length = 363 Score = 140 bits (354), Expect = 4e-38 Identities = 91/277 (32%), Positives = 148/277 (53%), Gaps = 26/277 (9%) Query: 8 NVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRV 67 ++ ++ G R+ DV L G ++ G SG GK++++ ++AGL G + +DGR + Sbjct: 5 DLRRRQGEFRL--DVRLSAGPGVTALY-GRSGSGKTSVINMVAGLSRPDEGSISVDGRVL 61 Query: 68 ND------LEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQIL 121 D L P R +G VFQ + L+PH+SV N+ FG KL + + + + + K ++L Sbjct: 62 FDSRSGIDLPPEARRLGYVFQEHRLFPHLSVRGNLEFGQKLLPSAERT--QSLDKVVELL 119 Query: 122 QLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHD 181 ++ LL R+P +LSGG++QRVA+GRA+ P ILL DEPL+ LD + + ++ IA+L Sbjct: 120 GIESLLDRRPAKLSGGEKQRVAIGRALLASPRILLMDEPLAALDPARKAEVLPFIAQLAR 179 Query: 182 RLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMNF 241 R ++YV+H E + LAD + +++GG+V G L +G P + Sbjct: 180 RFSVPILYVSHSMDEVLRLADTLALMDGGKVAASGPLESL------------MGDPGLRP 227 Query: 242 LSARLQTPGETSLV---DTLVWGITSLPFDSSNLAAG 275 L+ R + V +GI+ L FD L G Sbjct: 228 LTGRYEAGAVIGAVVSSHDSGFGISRLAFDGGTLIVG 264 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 363 Length adjustment: 30 Effective length of query: 351 Effective length of database: 333 Effective search space: 116883 Effective search space used: 116883 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory