Align Probable D-lactate dehydrogenase, mitochondrial; DLD; Lactate dehydrogenase D; EC 1.1.2.4 (characterized)
to candidate WP_011385361.1 AMB_RS15030 FAD-binding protein
Query= SwissProt::F1QXM5 (497 letters) >NCBI__GCF_000009985.1:WP_011385361.1 Length = 457 Score = 518 bits (1334), Expect = e-151 Identities = 252/443 (56%), Positives = 324/443 (73%), Gaps = 4/443 (0%) Query: 46 EGVSVGSAVREQHGRDESVHRCRPPDVVVFPRSVEEVSALAKICHHYRLPIIPFGTGTGL 105 E S AVREQHG+DES PP+ VVF +S EEV+ K C + P+I FGTGT L Sbjct: 17 ERFSTAQAVREQHGKDESHFPACPPEAVVFAQSTEEVAETVKACAAHGTPVIAFGTGTSL 76 Query: 106 EGGVGALQGGVCFSLRKMEQVVDLHQEDFDVTVEPGVTRKSLNSYLRDTGLWFPVDPGAD 165 EG V AL+GGVC + M +V+++ ED DVTV+PGVTRK LN YLRDTGL+FP+DPGAD Sbjct: 77 EGHVAALKGGVCIDVSGMNRVLEVRAEDLDVTVQPGVTRKQLNEYLRDTGLFFPIDPGAD 136 Query: 166 ASLCGMAATSASGTNAVRYGTMRENVLNLEVVLADGTILHTAGKGRRPRKTAAGYNLTNL 225 ASL GMAAT ASGTNAVRYGTMRENVL+L+VVL DG ++ TAG R RK++AGY+LT L Sbjct: 137 ASLGGMAATRASGTNAVRYGTMRENVLSLQVVLPDGRVIRTAG---RARKSSAGYDLTRL 193 Query: 226 FVGSEGTLGIITKATLRLYGVPESMVSAVCSFPSVQSAVDSTVQILQAGVPIARIEFLDD 285 FVGSEGTLGIIT+ TLRL G+PE++ +AVC FPS+++AV++ + +Q+GVP+ARIEFLD Sbjct: 194 FVGSEGTLGIITELTLRLQGIPEAISAAVCPFPSIEAAVNTVILTIQSGVPVARIEFLDK 253 Query: 286 VMINACNRFNNLSYAVTPTLFLEFHGSSKSMEEQVSVTEEITRDNGGSDFAWAEDEETRS 345 VMI A NR++ + PTLF EFHGS S++EQ E I + G F WA E R+ Sbjct: 254 VMIGAVNRYSKTDHREAPTLFFEFHGSPASVQEQAEKVEAIATEFGAEGFQWATGAEERT 313 Query: 346 RLWKARHDAWYAAMALRPGCKAYSTDVCVPISRLPQIIVETKADLISNNITGPIAGHVGD 405 +LW ARH+A+YA + LRPGC+A++TD CVPISRL + ++ET+ DL + + I GHVGD Sbjct: 314 KLWAARHNAYYAGVGLRPGCRAWTTDACVPISRLAECLLETEEDLKTTPLISAIVGHVGD 373 Query: 406 GNFHCLIVLDPNDTDEVQRVHSFTERLARRALAMDGTCTGEHGIGLGKRALLREEVGPLA 465 GNFH ++++DP +E R+ RRALAMDGTCTGEHG+G GK A L EE G A Sbjct: 374 GNFHVMLLVDPGKPEEAAEAERINHRIVRRALAMDGTCTGEHGVGHGKMAFLEEEYGE-A 432 Query: 466 IEVMKGLKASLDPRNLMNPGKVL 488 ++VM+ +K ++DP +MNPGK++ Sbjct: 433 LDVMRAVKRAIDPAGIMNPGKIV 455 Lambda K H 0.319 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 457 Length adjustment: 33 Effective length of query: 464 Effective length of database: 424 Effective search space: 196736 Effective search space used: 196736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory