Align L-lactate dehydrogenase (EC 1.1.1.27) (characterized)
to candidate WP_011386311.1 AMB_RS20025 malate dehydrogenase
Query= BRENDA::Q27797 (326 letters) >NCBI__GCF_000009985.1:WP_011386311.1 Length = 319 Score = 313 bits (803), Expect = 3e-90 Identities = 162/315 (51%), Positives = 216/315 (68%), Gaps = 7/315 (2%) Query: 8 RKKIAMIGSGMIGGTMGYLCVLRELADVVLFDVVTGMPEGKALDDSQATSIADTNVSVTS 67 RKKIA++GSG IGGT+ +L L+EL DVV+FD+ G+P+GK LD ++T + + + Sbjct: 3 RKKIALVGSGNIGGTLAHLIGLKELGDVVMFDIAEGIPQGKGLDILESTPVEGVDCRYSG 62 Query: 68 ANQYEKIAGSDVVIITAGLTKVPGKSDKEWSRNDLLPFNAKIIREVAQGVKKYCPLAFVI 127 AN Y IAG+DVVI+TAG+ + PG S R+DL+ N K++ V +G+KK CP AFVI Sbjct: 63 ANDYSAIAGADVVIVTAGVPRKPGMS-----RDDLVGINLKVMAAVGEGIKKNCPGAFVI 117 Query: 128 VVTNPLDCMVKCFHEASGLPKNMVCGMANVLDSARFRRFIADQLEISPRDIQATVIGTHG 187 +TNPLD MV SG+P NM+ GMA VLDSARFR F+ ++ +S D+ A V+G HG Sbjct: 118 CITNPLDVMVWALQHYSGVPANMIVGMAGVLDSARFRTFLCEEFNVSVEDVTAFVLGGHG 177 Query: 188 DHMLPLARYVTVSGFPLREFIKKGKMTEAKLAEIVERTKKAGGEIVRLLGQGSAYYAPAL 247 D M+PL RY TV+G PL + +K G T+ KL +IV+RT+ G EIV LL GSAYYAPA Sbjct: 178 DTMVPLVRYSTVAGIPLPDLVKMGWTTQEKLDQIVQRTRDGGAEIVNLLKTGSAYYAPAA 237 Query: 248 SAITMAQAFLKDEKRVLPCSVYCQ-GEYGL-HDMFIGLPAVIGGGGIEQVIELELTHEEQ 305 S + MA+AFLKD+KRVLP + + G YG D+F+G+P VIG GG+E+++E+EL EQ Sbjct: 238 SGVAMAEAFLKDKKRVLPVATLVKGGTYGQPDDVFVGVPVVIGEGGVERIVEIELNAAEQ 297 Query: 306 ECFRKSVDDVVELNK 320 F KS D V L K Sbjct: 298 AEFNKSADAVRGLVK 312 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 319 Length adjustment: 28 Effective length of query: 298 Effective length of database: 291 Effective search space: 86718 Effective search space used: 86718 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory