Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate WP_011383209.1 AMB_RS03925 glycine cleavage system protein T
Query= reanno::WCS417:GFF4369 (374 letters) >NCBI__GCF_000009985.1:WP_011383209.1 Length = 371 Score = 417 bits (1072), Expect = e-121 Identities = 208/373 (55%), Positives = 261/373 (69%), Gaps = 5/373 (1%) Query: 2 STETLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHLHTRDQAGLFDVSHMGQIR 61 S +L PL ALH ELGA+MVPFAGY MPVQYP GV+ EHLHTR A LFDVSHMGQ Sbjct: 4 SETPMLTVPLDALHRELGAKMVPFAGYSMPVQYPAGVLAEHLHTRSGAALFDVSHMGQAS 63 Query: 62 LTGANAAKALETLVPVDILDLPVGMQRYAMFTNDQGGILDDLMVANLGNEELFLVVNAAC 121 + GA A + LETLVP DI L +G RY++FTNDQGGILDDLM++ L + LFLV+NAAC Sbjct: 64 IRGAKAVELLETLVPGDIQALGLGKTRYSVFTNDQGGILDDLMISKLAEDHLFLVINAAC 123 Query: 122 KDQDLAHLRQHIGDQCTIEPLFEERALLALQGPAAVKVLARLAPEVTKMTFMQFATLRLL 181 K D AHL+ H+GD+ + + E+R+LLALQGP A + L PE MTFM A + + Sbjct: 124 KHADFAHLKAHLGDKVELS-MIEDRSLLALQGPGAAAAMVTLCPEAGAMTFMTIAEITVA 182 Query: 182 GVDCYVSRSGYTGEDGFEISVPAANAESLARSLLAETEVQAIGLGARDSLRLEAGLCLYG 241 G+ C +RSGYTGEDG+EISV A+ E+LAR++LA V GLGARDSLRLEAGLCLYG Sbjct: 183 GIKCLATRSGYTGEDGWEISVANADVETLARAILAAPGVMPAGLGARDSLRLEAGLCLYG 242 Query: 242 HDMNTDTTPIEASLLWAISKARRADGARAGGFPGADTIFTQQQAGVSRKRVGLLPQERTP 301 D++T TTP+EAS+ W +SK RRA+ GGFPGA I Q G R+RVG+ P + P Sbjct: 243 SDIDTTTTPVEASIAWIMSKRRRAE----GGFPGAAVIQKQLAEGAPRRRVGIQPDGKAP 298 Query: 302 VREGAQIVDADGTVIGSVCSGGFGSTLGGPLAMGYLDSAFIALDTEVSALVRGKKVPLRV 361 R +I D G +G +CSGGFG + GGP+AMGY+ +AF + T++ +VRGK + V Sbjct: 299 ARAHTEITDEAGNRLGEICSGGFGPSAGGPVAMGYVPAAFAGVGTKLKLVVRGKAMDAHV 358 Query: 362 SKMPFVPQRYYRG 374 +PFVP RY++G Sbjct: 359 CDLPFVPHRYFKG 371 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 371 Length adjustment: 30 Effective length of query: 344 Effective length of database: 341 Effective search space: 117304 Effective search space used: 117304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_011383209.1 AMB_RS03925 (glycine cleavage system protein T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.17278.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-103 332.2 0.0 2e-103 332.0 0.0 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011383209.1 AMB_RS03925 glycine cleavage sys Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011383209.1 AMB_RS03925 glycine cleavage system protein T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 332.0 0.0 2e-103 2e-103 4 361 .. 11 365 .. 8 366 .. 0.95 Alignments for each domain: == domain 1 score: 332.0 bits; conditional E-value: 2e-103 TIGR00528 4 tpLydlhtelggklvdfaGwelPvqy.kslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllan 71 pL lh elg+k+v+faG+++Pvqy +++ eh +r a lfDvshmg+ +++G k++++L+ l++ lcl|NCBI__GCF_000009985.1:WP_011383209.1 11 VPLDALHRELGAKMVPFAGYSMPVQYpAGVLAEHLHTRSGAALFDVSHMGQASIRGAKAVELLETLVPG 79 58899*********************55779************************************** PP TIGR00528 72 DvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlske 140 D++aL Gk++ysv+ n qGG++DDl++ k +ed ++ lv+naa+++ D ++lk hl ++v+l + ++ lcl|NCBI__GCF_000009985.1:WP_011383209.1 80 DIQALGLGKTRYSVFTNDQGGILDDLMISKLAED-HLFLVINAACKHADFAHLKAHLGDKVELSMI-ED 146 **********************************.999**********************999765.66 PP TIGR00528 141 isllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwk 209 sllalqGP a++ + l +a +++ f+ + e +a+ k+l +r+GytGedG+ei+van + l++ lcl|NCBI__GCF_000009985.1:WP_011383209.1 147 RSLLALQGPGAAAAMVTLCPEA-GAM-TFMTIAEITVAGIKCLATRSGYTGEDGWEISVANADVETLAR 213 89********999999888654.444.6778888899999***************************** PP TIGR00528 210 klveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker.kksdfiGravleeqken 277 ++++a+gv P GLgarD+Lrleag++LyG ++d ++tP+ea++ w+++k r ++ f G av+++q ++ lcl|NCBI__GCF_000009985.1:WP_011383209.1 214 AILAAPGVMPAGLGARDSLRLEAGLCLYGSDIDTTTTPVEASIAWIMSKRRrAEGGFPGAAVIQKQLAE 282 ***********************************************99875899************** PP TIGR00528 278 gtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtklevevr 346 g+ +++vG++ k ar + ++ ++ ++ G + sG + P g +a++yv+ ++++Gtkl+ vr lcl|NCBI__GCF_000009985.1:WP_011383209.1 283 GAPRRRVGIQPDGKAPARAHTEITD-EAGNRLGEICSGGFGPSAGGPVAMGYVPAAFAGVGTKLKLVVR 350 *************************.55599************************************** PP TIGR00528 347 nklvkikvvkklfvr 361 +k ++++v +fv+ lcl|NCBI__GCF_000009985.1:WP_011383209.1 351 GKAMDAHVCDLPFVP 365 ***********9996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.43 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory