Align 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase; AONS/AKB ligase; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Alpha-oxoamine synthase; Glycine acetyltransferase; EC 2.3.1.29; EC 2.3.1.47 (characterized)
to candidate WP_011385138.1 AMB_RS13875 8-amino-7-oxononanoate synthase
Query= SwissProt::Q5SHZ8 (395 letters) >NCBI__GCF_000009985.1:WP_011385138.1 Length = 392 Score = 242 bits (617), Expect = 2e-68 Identities = 142/353 (40%), Positives = 205/353 (58%), Gaps = 11/353 (3%) Query: 37 RVEGREVVNLASNNYLGFANHPYLKEKARQYLEKWGAGSGAVRTIAGTFTYHVELEEALA 96 RV GRE+VN +SN+YLG + HP + E++R++L ++GAGSGA R + G LE +A Sbjct: 36 RVGGRELVNFSSNDYLGLSRHPEVVERSRRWLNEYGAGSGASRLVTGHLAAMEALEAKIA 95 Query: 97 RFKGTESALVLQSGFTANQGVLGALLKEG-----DVVFSDELNHASIIDGLRLTKATRLV 151 R K TE+AL+L SG+ N VL ALL + +VF+D+L HAS+ GL L+ A R Sbjct: 96 RCKQTEAALILASGWQCNASVLPALLDKALWGAEPLVFADKLIHASLHAGLELSGARRYR 155 Query: 152 FRHADVAHLEELLKAH-DTDGLKLIVTDGVFSMDGDIAPLDKIVPLAKKYKAVVYVDDAH 210 +RH D+ HLE LLKAH D +G + IVT+ VFSMDGD+ + + LA ++ A +YVD+AH Sbjct: 156 YRHDDLDHLESLLKAHADKEGPRFIVTETVFSMDGDVTDMAALAALASRWDAFLYVDEAH 215 Query: 211 GSGVLGEKGKGTVHHFGFHQDPDVVQVATLSKAWAGIGGYAAGARELKDLLINKARPFLF 270 +GVLG G G G + + T SK G Y A + L+ LIN+A ++ Sbjct: 216 ATGVLGANGFGLSPGMGAE-----LAMGTFSKGLGSFGAYVACSARLRHYLINRASGLIY 270 Query: 271 STSHPPAVVGALLGALELIEKEPERVERLWENTRYFKRELARLGYDTLGSQTPITPVLFG 330 +T PPAV+GA+ AL+L+ + RL R + L G DT S + I P++ G Sbjct: 271 ATGLPPAVLGAIDAALDLVPRLEGERTRLQMMGRRLRDGLRAAGLDTGPSASQIVPLILG 330 Query: 331 EAPLAFEASRLLLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTKEMLDKALEA 383 + ++ L + G+ + I PTVP G +RIR ++A H+ LD+ L A Sbjct: 331 DEGRTLAVAKALEDRGILGIAIRPPTVPPGTSRIRFALSAVHSDADLDRLLAA 383 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 392 Length adjustment: 31 Effective length of query: 364 Effective length of database: 361 Effective search space: 131404 Effective search space used: 131404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory