Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate WP_011385594.1 AMB_RS16305 electron transfer flavoprotein subunit alpha
Query= BRENDA::H6LBB1 (418 letters) >NCBI__GCF_000009985.1:WP_011385594.1 Length = 312 Score = 143 bits (361), Expect = 6e-39 Identities = 100/323 (30%), Positives = 166/323 (51%), Gaps = 14/323 (4%) Query: 74 ITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKY-GVDKVF 132 I V +H G + T + A + IG V+ L+ G+ I A+ K GV KV Sbjct: 3 ILVIAEHEGGALKSATLNTVSAASK----IGGDVHVLVAGSGIGAVAEAAAKVAGVAKVL 58 Query: 133 VYDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTI 192 D + + EP A ++ S IL AT G+++APRVAA ++ T Sbjct: 59 SADAALYANHLAEPLAALVVSLAGSY--SHILAPATTGGKNVAPRVAALLDVAQISEITA 116 Query: 193 LEMKENTDLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTAPERVNEPWGDVEMMDIE 252 + + +RP + GN +A + +++ + TVR F A + VE + Sbjct: 117 VVSPDTF----VRPIYAGNALATVQSKDA-VKVITVRGTGFEAAKAEGGS-AAVEAVSAA 170 Query: 253 KAKLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDLDMIHEFAEKIGATVACTRP 312 +S+ ++ K E+ +L+ A I++ GRG++ + ++ A+K+GA V +R Sbjct: 171 ADPALSSFVGSQLSKSERP-ELTSARIIISGGRGMQSGDNFHLLEAVADKLGAAVGASRA 229 Query: 313 GIEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNI 372 ++AG+ Q+G +G+ V P L IA+GISGA+Q AGM++S+ I+AIN D +APIF + Sbjct: 230 AVDAGFVPNDFQVGQTGKIVAPDLYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQV 289 Query: 373 AHCGMVGDLYEILPELLTMIEGP 395 A G+V DL+++LPE ++ P Sbjct: 290 ADYGLVADLFKVLPEFTAALQSP 312 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 312 Length adjustment: 29 Effective length of query: 389 Effective length of database: 283 Effective search space: 110087 Effective search space used: 110087 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory