Align L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (characterized, see rationale)
to candidate WP_011386479.1 AMB_RS20890 iron-sulfur cluster-binding protein
Query= uniprot:Q8EGS5 (464 letters) >NCBI__GCF_000009985.1:WP_011386479.1 Length = 478 Score = 291 bits (744), Expect = 4e-83 Identities = 163/406 (40%), Positives = 232/406 (57%), Gaps = 17/406 (4%) Query: 1 MAYQHNHEAMGSQVHAYKADIFCRDETRVDWHSKALWLLREKRDRAAGSLPEWEQLRQLG 60 MA + + G++ H D R R +A+ L KR EW LR G Sbjct: 1 MAAEASKMEFGAKAHVALNDPKLRANFR-----RAMDGLMTKRAAQFADEAEWNALRARG 55 Query: 61 SEIKLHTLTNLAQYLETFEQNCLANGIKVHWAKDGAEHNRIVHEILASHKVKKLVKSKSM 120 + + + L L + LE E NCL NGI VHWA+ AE N IV IL + + ++K KSM Sbjct: 56 AAARANALAKLPELLEQLEANCLRNGIHVHWAETTAEANAIVLGILEAAGARTVIKGKSM 115 Query: 121 LTEECHLNPYLEQRGIEVIDTDLGERIIQLAKMPPSHIVVPAIHMKKEEVGDLFHDKLGT 180 +TEE HLN +LE+ GI +++DLGE IIQLA PSHIV+P IH K E+ +LFHDK+ Sbjct: 116 VTEEMHLNAHLEKHGITPVESDLGEYIIQLAGEAPSHIVMPCIHKNKTEIAELFHDKIEG 175 Query: 181 KAGESDPLYLTRAARAHLREQFLSADAAMTGVNMAIADKGAVVVCTNEGNADMGANLPKL 240 + + LT AARA LR F ADA ++GVN A+A+ G +V+ NEGN + LP L Sbjct: 176 QPYTENVDELTAAARAALRGAFAGADAGISGVNFAVAETGTLVLIENEGNGRLSTTLPPL 235 Query: 241 QLHSMGIDKVVPDIDSAAVLLRTLARNATGQPVTTYSAFYRGPQVDGE------MHVIIV 294 + GI+KV+ +D LL L R+ATGQP+TTY P+ +GE +H++++ Sbjct: 236 HIAVTGIEKVLEKLDDVPPLLSLLPRSATGQPITTYVNMISSPRKEGEKDGPKAVHLVLL 295 Query: 295 DNGRTEMMKDKILAESLKCIRCGGCLNTCPVYRRSGGYSYNYTIPGPIGIAVGATHDNTN 354 DNGR+ + D L ++L+CIRC C+N CPVY R GG++Y +T PGPIG + + + Sbjct: 296 DNGRSRVHGDTELRDTLRCIRCAACMNHCPVYTRVGGHTYTFTYPGPIGKLLTPQIEGLD 355 Query: 355 SIA---WACTLCGSCTYVCPTKVPLDKIIHHHRRLKAEAGKLPYGK 397 A TLC +C VCP ++P+ ++ RL+ E+ + G+ Sbjct: 356 CAGDQPHASTLCRACADVCPVQIPIPDLL---VRLRTESVRPTQGQ 398 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 478 Length adjustment: 33 Effective length of query: 431 Effective length of database: 445 Effective search space: 191795 Effective search space used: 191795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory