GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Magnetospirillum magneticum AMB-1

Align propionate-CoA ligase (EC 6.2.1.17) (characterized)
to candidate WP_011384701.1 AMB_RS11645 propionyl-CoA synthetase

Query= BRENDA::A0A0G2K047
         (683 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384701.1 AMB_RS11645 propionyl-CoA
           synthetase
          Length = 638

 Score =  708 bits (1828), Expect = 0.0
 Identities = 338/623 (54%), Positives = 447/623 (71%), Gaps = 2/623 (0%)

Query: 58  YKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHI 117
           Y+  +  S+ DPE FWG+AA++I WYK W K L++   P   WFV    N CYNA+DRH+
Sbjct: 5   YQQAYEKSLKDPEGFWGEAAKEIHWYKTWDKVLDDSKKPFYRWFVGAETNTCYNAVDRHV 64

Query: 118 ENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQA 177
           E G+G + AIIYDSPVT TK  ISY E+ +QVS+LAG +   GV KGD V++YMPM+P+A
Sbjct: 65  EQGRGAQTAIIYDSPVTSTKRKISYDELKDQVSRLAGAMAALGVAKGDRVLLYMPMVPEA 124

Query: 178 IYAMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEA 237
           +  MLA AR+GAIHS++FGGFA  EL+TRI+  KPKV+++AS GIE  R + Y P+L+EA
Sbjct: 125 VVGMLAVARLGAIHSVVFGGFAPAELATRINDAKPKVILSASCGIEGSRVIAYKPMLDEA 184

Query: 238 LRIGQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSG 297
           + + +HKP   ++  RP    V   +G DLDW E  AKA+  DCVPVL+  PLYILYTSG
Sbjct: 185 IALSEHKPGHTIMLQRPQSVAVMDKAG-DLDWTEVCAKAKPADCVPVLATDPLYILYTSG 243

Query: 298 TTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNT 357
           TTG PKGVVR  GG+ V L W+M  +Y +KPGEV+WAASD+GWVVGHSYICY PLL+G+T
Sbjct: 244 TTGQPKGVVRDNGGHMVALMWSMKYVYDIKPGEVFWAASDVGWVVGHSYICYAPLLNGST 303

Query: 358 TVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTL 417
           TV+YEGKPVGTPDAGA++R+++E+ +A+LFTAPTA RAI+++DP   L K+Y LT F+ L
Sbjct: 304 TVVYEGKPVGTPDAGAFWRMISEYKMASLFTAPTAFRAIKREDPNGELLKKYDLTGFRAL 363

Query: 418 FVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPG 477
           F+AGER D +T+ W+++  +VPV+DHWWQTETG  I A+C+GL +     PG   K VPG
Sbjct: 364 FLAGERSDPDTINWAREKLKVPVVDHWWQTETGWAIAANCLGL-HEFPIKPGSPTKPVPG 422

Query: 478 YNVMILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAG 537
           + + +LD+  Q  +A  +G++VV+LPLPPGA   LW   +     Y+ +FPG Y T DAG
Sbjct: 423 WGLEVLDEGHQPCEAGKVGSLVVRLPLPPGALLTLWNADQRCIDSYYSEFPGCYKTADAG 482

Query: 538 YMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVTDCAVVGKEDPLKGHVPLAL 597
            +DE+GY Y+MSR DD+INVAGHR+S G +EE + SH  V +CAV+G  D LKG +PL  
Sbjct: 483 MIDEDGYAYIMSRTDDIINVAGHRLSTGGMEEVLASHPDVAECAVIGVADQLKGQLPLGF 542

Query: 598 CVLKKDVNATEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNG 657
             LK  V    +QV+ E+VK VR+ IGPVAAF+    V +LPKTRSGKI R T+  + + 
Sbjct: 543 ICLKAGVTKPHDQVIAEVVKLVREKIGPVAAFKTCTVVNRLPKTRSGKILRGTMQKIADN 602

Query: 658 KPYKVTPTIEDPSIFGHIEEVLK 680
           + +K+  TI+DPSI   I E L+
Sbjct: 603 QDFKMPATIDDPSILDEIGESLE 625


Lambda     K      H
   0.318    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1339
Number of extensions: 61
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 683
Length of database: 638
Length adjustment: 38
Effective length of query: 645
Effective length of database: 600
Effective search space:   387000
Effective search space used:   387000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory