GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treEIIA in Magnetospirillum magneticum AMB-1

Align D-trehalose PTS system, I, HPr, and IIA components (characterized)
to candidate WP_011386738.1 AMB_RS22220 phosphoenolpyruvate--protein phosphotransferase

Query= reanno::WCS417:GFF4500
         (838 letters)



>lcl|NCBI__GCF_000009985.1:WP_011386738.1 AMB_RS22220
           phosphoenolpyruvate--protein phosphotransferase
          Length = 596

 Score =  317 bits (812), Expect = 1e-90
 Identities = 211/589 (35%), Positives = 312/589 (52%), Gaps = 32/589 (5%)

Query: 258 VAEPVATQSSATLLRGVCASPGSAFGQVV-----QVTDPELVITEQGTGGATERAALTRG 312
           V    AT  +  +  G+  S G A G +       +T PEL I         E A     
Sbjct: 10  VGRSKATARAELVRDGLGVSRGIAIGTLYLHDAGTITVPELRIPAARLDA--ECARFNEA 67

Query: 313 LLAANEALQVLQDKA------AGSAQAEIFRAHQELLEDPTLLEHAH-RLLGEGKSAAFA 365
              A   ++ LQDKA      AG     +  A++++L    LL     R+  +  +A  A
Sbjct: 68  SANAGRQVEQLQDKAGRLGGAAGEELGYLLDAYRQMLHGSRLLRGVEARIRNDRINAEAA 127

Query: 366 WNSATLATVTLFQGLGNALIAERAADLADVGQRVLKLILGIQDSAWD-LPERAILIAEQL 424
                   V  F+ + +  +A R AD+ D+G+R+L+ +       +  LP  A+++AE++
Sbjct: 128 VQQEINEIVRGFEAMEDPYLAARVADIKDIGRRLLRALTNTAYRPFTALPRNAVIVAEEM 187

Query: 425 TPSQTASLDTRKVLGFVTVAGGATSHVAILARALGLPAICGVPAQVLALANGKQVLLDAD 484
           TP+ TA LD  +V G  TV GG+  H AI+AR+LGLP++ G+   +  +  G+QV++D  
Sbjct: 188 TPADTALLDPNQVAGLATVMGGSEGHTAIMARSLGLPSVLGIADLLTGVKGGEQVIIDGT 247

Query: 485 KGELHLEPN---LAEIEQLEAA--RKHQVLRHQRDVAQASLPATTRDGHHVEVTANVASL 539
            G + + P    LA   +  AA  +  +VL   +DV     PA TRDG  + + AN+   
Sbjct: 248 NGLVVINPGPETLAFYRRERAAFLKARRVLSRLKDV-----PAVTRDGGRITLQANMELP 302

Query: 540 QEVEHALTLGGEGVGLLRSEFLYLDRNRAPSPEEQAGTYTAIARALGTERNLVVRTLDVG 599
            EV   L  G EG+GLLRSEFLY++R+  PS +EQ      +   +G  R + VRT D G
Sbjct: 303 NEVGAVLDSGAEGIGLLRSEFLYMNRDDVPSEDEQYAILKDVVERMGG-RTVTVRTFDAG 361

Query: 600 GDKPLAYVPMDAETNPFLGLRGIRLCLERPQLLREQFRAILASAGFARLHIMLPMVSLLS 659
           GDK    +      NP LGLR IRL L R  LL  Q  AIL ++    + I++PM++ + 
Sbjct: 362 GDKLAPALGCTIGPNPSLGLRAIRLGLARQDLLEAQLAAILRASAHGPVRILIPMIATVG 421

Query: 660 ELHLARKILEEEALAL---GLT---ELPKLGIMIEVPSAALMADVFAPHVDFFSIGTNDL 713
           EL   R+++      L   G++    LP+LG MIE+P AAL AD  A H DFF+IGTNDL
Sbjct: 422 ELRATREVMNRVIRRLRKAGVSLPDPLPRLGAMIEIPGAALSADSIAWHADFFAIGTNDL 481

Query: 714 TQYTLAMDRDHPRLANQADSFHPAVLRLIATTVKAAHAHGKWVGVCGALASEALAVPVLI 773
            QYTLA+DR    +A+  +  HPAVLRLI  T +AA      V VCG +A +    P+L+
Sbjct: 482 VQYTLAIDRSDEAVAHLYNPLHPAVLRLIQFTTQAAQRANIPVSVCGEMAGDPRYAPLLL 541

Query: 774 GLGVDELSVSVPLIPTIKATVRELDLADCQIIARQVLGLEEAAEVREAL 822
           GLG+ +LS+S   +P +K  +R LDLA  + +AR V+   ++ ++ + L
Sbjct: 542 GLGLRDLSMSTSNLPVVKNRIRSLDLAAAETLARTVMEQTDSGKIGQLL 590


Lambda     K      H
   0.318    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1069
Number of extensions: 45
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 838
Length of database: 596
Length adjustment: 39
Effective length of query: 799
Effective length of database: 557
Effective search space:   445043
Effective search space used:   445043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory