Align Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component; EC 1.18.1.3 (characterized)
to candidate WP_083763535.1 AMB_RS15180 hypothetical protein
Query= SwissProt::Q84BZ0 (406 letters) >NCBI__GCF_000009985.1:WP_083763535.1 Length = 676 Score = 140 bits (353), Expect = 1e-37 Identities = 114/344 (33%), Positives = 162/344 (47%), Gaps = 12/344 (3%) Query: 7 VIVGAGHAARRTAEALRARDADA-PIVMIGAERELPYDRPALSKDALLNDDGEQRAFVRD 65 V+VG G AA RT E + A D I ++GAE Y+R LS L D Sbjct: 45 VVVGNGMAALRTVEEILALAPDRFHITVLGAEPHGNYNRILLSS-VLAGDKQVGDIVTHP 103 Query: 66 AAWYDAQRIALRLGTRVDAIEREAQRVRLDDGTTLPYAKLVLATGSRVRTFGGPIDAGVV 125 WY + IALR G V +I+ E +RV G + + +L+LATG+R P AG+ Sbjct: 104 PGWYAERGIALRTGDPVVSIDPEHRRVSTASGHVVAWDRLLLATGARPLMPALP-GAGLE 162 Query: 126 AHY-VRTVADARALRAQLVRGRRVAVLGGGFIGLEVAAAARQLGCNVTVIDPAARLLQRA 184 Y RT+ D +A+ A R RR V+GGG +GLE A R+ G VTVI L++R Sbjct: 163 GVYGFRTIGDVQAMLASAGRHRRAVVVGGGVLGLEAAWGLRRQGMAVTVIHLTPWLMERQ 222 Query: 185 LPEVVGAYAHRLHDERGVGFQMATLPRAIRAAAGGGAIVETDRGDVHADVVVVGIGVLPN 244 L EV A + G+ + + A+ +D + AD+VV+ +G+ PN Sbjct: 223 LDEVAAAMLRHDLERHGIACLTSAQAARLEGRERVEAVTLSDGRTIAADLVVMAVGIRPN 282 Query: 245 VELAQAAGLDVDNGIRVDAGCRTADRAIFAAGEVTMHFNPLLGRHVRIESWQVAENQPAV 304 +LA+ AGL+V GI VDA R++ IFA GE H G + + W +A V Sbjct: 283 TDLARQAGLEVGRGITVDARMRSSAPDIFAVGECVEHDGQCYG--LVMPLWDMAR----V 336 Query: 305 AAANLLGADDAYAELPWLWSDQYDCNLQMLGLFGAGQTTVVRGD 348 A +L G + P S + + + LF AG+ D Sbjct: 337 CAHHLTGGEGERLFTPPSLSTR--LKIPGIALFSAGEPAAANDD 378 Lambda K H 0.322 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 39 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 676 Length adjustment: 35 Effective length of query: 371 Effective length of database: 641 Effective search space: 237811 Effective search space used: 237811 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory