Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_011382725.1 AMB_RS01410 cobalt ABC transporter
Query= uniprot:P40735 (281 letters) >NCBI__GCF_000009985.1:WP_011382725.1 Length = 264 Score = 144 bits (363), Expect = 2e-39 Identities = 86/248 (34%), Positives = 137/248 (55%), Gaps = 4/248 (1%) Query: 16 YRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAG--IQL 73 YR AL G+ L V G LA++G NG+GK+TL LNG + P +G + + G + Sbjct: 10 YRYPGGVAALSGLDLGVERGRRLAVLGPNGAGKTTLLLHLNGTLKPSAGTVRLGGEIMGY 69 Query: 74 TEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQ 133 + ++ R+++G+V Q PD+Q TV +DV+FG N G+ E RV+ A+ + + Sbjct: 70 SRAALTGWRRRVGLVLQEPDDQLFAATVAEDVSFGPLNLGLSEAETRRRVEAALDALGIS 129 Query: 134 DFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGM 193 D + H LS GQK+RVAIAG +A P++++LDE + LD G + +L + L G Sbjct: 130 DLAGRATHMLSFGQKKRVAIAGALAMEPEVLLLDEPLAGLDHQGGKRLLAALDALARAG- 188 Query: 194 ATVISITHDLNEA-AKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLDLPFSFQLSQL 252 T++ TH+++ A ADR+ + G+ A+G E+ + L GL++P +L Sbjct: 189 TTLVFTTHEVDLAHGFADRVALFRDGRVIAQGEAAEVLSDRECLAACGLEMPLLLELGVR 248 Query: 253 LRENGLAL 260 R+ LAL Sbjct: 249 TRDEALAL 256 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 264 Length adjustment: 25 Effective length of query: 256 Effective length of database: 239 Effective search space: 61184 Effective search space used: 61184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory