Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate WP_011383120.1 AMB_RS03480 isovaleryl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >NCBI__GCF_000009985.1:WP_011383120.1 Length = 389 Score = 254 bits (649), Expect = 3e-72 Identities = 136/364 (37%), Positives = 210/364 (57%) Query: 12 DAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTGYLAYAMAL 71 D+ FA + P AAE DR + FP E + +G G+ V E++GG GYL + +A+ Sbjct: 21 DSVAAFAATEIAPRAAEIDRSNEFPNELWPRLGAMGLLGITVDEKYGGAGMGYLEHVVAM 80 Query: 72 EEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFALTEPQAGSD 131 EEI+ + H+++ I + G + QK ++L L SG +GA A++EP AGSD Sbjct: 81 EEISRASASVGLSYGAHSNLCVNQIKRNGTEAQKMKYLPKLISGEYIGALAMSEPNAGSD 140 Query: 132 ASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFIVPTDSPGY 191 S+K +A GD YVLNG K +IT+G +A V++V+A TD +AG RGI+AF+V G+ Sbjct: 141 VVSMKLKAEKKGDRYVLNGTKMWITNGPDADVIVVYAKTDVTAGPRGITAFLVEKTFKGF 200 Query: 192 KVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRVGIASQSVGM 251 VA+ DKLG S+T +++F+D +VP N LG G+G + ++ L+ RV + +G+ Sbjct: 201 SVAQKLDKLGMRGSNTGELVFQDCEVPEENVLGAVGKGVNVLMSGLDYERVVLTGGPLGI 260 Query: 252 ARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALRDSGKPAL 311 A + Y ER FG+PI Q + +LADM T R + A D G+ + Sbjct: 261 MAACMDVVVPYVHERTQFGQPIGTFQLMQGKLADMYTTFNACRAYTYAVAKACDRGETSR 320 Query: 312 VEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEGTSDIQRMVI 371 +A+ L+ +E A + A+QTLGG GY++++ R+ RD ++ +I GTS+I+RM+I Sbjct: 321 KDAAGVILYGAEKATWMALEAIQTLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLI 380 Query: 372 SRNL 375 R L Sbjct: 381 GREL 384 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 389 Length adjustment: 30 Effective length of query: 345 Effective length of database: 359 Effective search space: 123855 Effective search space used: 123855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory