Align branched-chain-2-oxoacid decarboxylase (subunit 2/2) (EC 4.1.1.72) (characterized)
to candidate WP_083763391.1 AMB_RS00370 hypothetical protein
Query= BRENDA::Q9HIA4 (319 letters) >NCBI__GCF_000009985.1:WP_083763391.1 Length = 654 Score = 137 bits (346), Expect = 6e-37 Identities = 95/287 (33%), Positives = 145/287 (50%), Gaps = 21/287 (7%) Query: 3 MVQALNSAMDLKMSEDDSVIILGEDVGRD-GGVFRVTDGLQAKYGPQRVIDTPLSELGIV 61 +V+ + + +D M+ DD +++LGED+ GG F+VT GL Y P RV +TP+SE G+V Sbjct: 329 LVEHIRAGLDAAMAADDRLLLLGEDICSPYGGAFKVTSGLSDSY-PGRVFNTPISEAGLV 387 Query: 62 GMAIGMAVNGLKPIPEIQFQDFIYTSMDQIINQMAKIRYRSGGDYTVPLVLRTPVGGGIK 121 G+ G+A+ G + + EI F DF+ DQ+IN AK G D VPL++RTP+GG Sbjct: 388 GVGAGLALAGRRVVAEIMFGDFLTLVADQLINHAAKFTQMYGEDVEVPLLVRTPMGGRRG 447 Query: 122 GGLYHSQSGEAYFAHTAGLTVVSPSNPYDAKGLLISAI-ESPDPVIFLEPK--------- 171 G HSQS E +F GLTV++ + DA I + P + +E K Sbjct: 448 YGPTHSQSLETHFFGVPGLTVLAIHHRMDAAAFYARLIATAKTPHLIIENKVAYGVDCAR 507 Query: 172 -RLYRAQKVEVPDEKYTIPLRKANVLKQGNDVTIVTYGSMVPTVMSVASKSKYDVEVIDL 230 RL VE D+ T+ +R + VTI+ YG M+ + + D +++ Sbjct: 508 DRLQGFSYVETDDDLPTLVVRPCVQAQ----VTILGYGGMLLEMEKAMDRLFEDADIVTE 563 Query: 231 R----TIAPMDRDTIISSVKKTGRVVIVHEAPRTLGVGAEISAMISE 273 + P + ++ SV T R+V+V E G GAE A + + Sbjct: 564 AICPVALYPSNMQALLDSVSLTRRLVVVEEGQGYAGYGAEAVAFLHQ 610 Lambda K H 0.318 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 654 Length adjustment: 33 Effective length of query: 286 Effective length of database: 621 Effective search space: 177606 Effective search space used: 177606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory