Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_083763604.1 AMB_RS09125 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000009985.1:WP_083763604.1 Length = 257 Score = 334 bits (856), Expect = 1e-96 Identities = 169/255 (66%), Positives = 199/255 (78%), Gaps = 1/255 (0%) Query: 22 MKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITFNQKSGKQY 81 M+FGGL A+ND SF A +ITA+IGPNGAGKTT+FNCITGFYKP +G +T + SG Sbjct: 1 MRFGGLFAVNDLSFSAAPKEITAVIGPNGAGKTTLFNCITGFYKPQVGRMTLDHPSGPM- 59 Query: 82 LLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTILGLIGVGPY 141 LLERL DF I+ +A VARTFQNIRLF+ ++VLENL+VAQH LM+AS +++ GL+G+ Y Sbjct: 60 LLERLDDFAISAKAGVARTFQNIRLFARMSVLENLIVAQHTTLMRASAFSLAGLLGLSRY 119 Query: 142 KREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELLCLDEPAAG 201 R A A+E AR WL+K L AD+ AG LPYG QRRLEIARAMCTGP LLCLDEPAAG Sbjct: 120 ARAEARAVERARHWLDKVGLTSLADEEAGSLPYGHQRRLEIARAMCTGPLLLCLDEPAAG 179 Query: 202 LNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISDGTPDHVKN 261 LNPRESA LN LL IR E G +LLIEHDMSVVMEISDH+VVL+YG+KI++G P +K Sbjct: 180 LNPRESAELNRLLLDIRDENGIGLLLIEHDMSVVMEISDHIVVLDYGKKIAEGAPAAIKA 239 Query: 262 DPRVIAAYLGVEDEE 276 DP VI AYLG DEE Sbjct: 240 DPAVIRAYLGEPDEE 254 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 257 Length adjustment: 25 Effective length of query: 267 Effective length of database: 232 Effective search space: 61944 Effective search space used: 61944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory