Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_011384081.1 AMB_RS08460 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000009985.1:WP_011384081.1 Length = 315 Score = 187 bits (474), Expect = 4e-52 Identities = 112/304 (36%), Positives = 173/304 (56%), Gaps = 16/304 (5%) Query: 16 LAGYSLISVLVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAY 75 LA +++ L +G N ++ + N IL VGLNL++G++GQ SLGHAGF A+GAY Sbjct: 11 LAALAIVITLAPLGFSNSYFYDVGVNAMFNAILCVGLNLLIGYAGQISLGHAGFFALGAY 70 Query: 76 AAAIIGSKSPTYGA-FFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIF 134 + I+ + YG GA+++ A + G +A +V P L+LKG YLA+ATLG+ II I Sbjct: 71 GSGILTER---YGVPAIGALVLSASVVGILAFVVARPILKLKGHYLAMATLGIGIIIHIV 127 Query: 135 IINGGSLTNGAAGILGIPNFTTW-------QMVYF----FVVITTIATLNFLRSPIGRST 183 + +T G G + + NF QM Y+ +V+ +LN + SP+GR+ Sbjct: 128 LKTEAGITGGPDG-MSLGNFKMLGFTIKGDQMWYWVTGVLLVLAVWLSLNLIESPVGRAL 186 Query: 184 LSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVL 243 +V E+ AE VGV+T+ K++ FV A+ AS+ GSL A G + P +F +S+ ++ Sbjct: 187 RAVHGSEVGAEVVGVDTSSYKVLVFVVSAVFASVVGSLFAHKNGFITPDISSFFHSVELV 246 Query: 244 IIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVMIFRPGGLLGTWEL 303 +VV GG+ SI GA++ A++L +L +L V +I ++ MIF P GLL + Sbjct: 247 TMVVLGGMASIYGALIGAVILTLLPQVLAAVEQYEAMILGAIMMGTMIFMPKGLLPSLLA 306 Query: 304 SLSR 307 SL R Sbjct: 307 SLKR 310 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 315 Length adjustment: 27 Effective length of query: 291 Effective length of database: 288 Effective search space: 83808 Effective search space used: 83808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory