Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_011385763.1 AMB_RS17210 molybdenum import ATP-binding protein ModC
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000009985.1:WP_011385763.1 Length = 363 Score = 137 bits (346), Expect = 4e-37 Identities = 99/313 (31%), Positives = 158/313 (50%), Gaps = 31/313 (9%) Query: 23 LDLHIGDGEFVVLL-GPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVND------LPARE 75 LD+ + G V L G SG GK++++ M+AGL G++ + G V+ D LP Sbjct: 15 LDVRLSAGPGVTALYGRSGSGKTSVINMVAGLSRPDEGSISVDGRVLFDSRSGIDLPPEA 74 Query: 76 RNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRAM 135 R + VFQ + L+PH+SV N+ FG + L P+AE + + +V LL +E+LL+R+P + Sbjct: 75 RRLGYVFQEHRLFPHLSVRGNLEFGQKLL--PSAERTQSLDKVVELLGIESLLDRRPAKL 132 Query: 136 SGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQ 195 SGG++QR AI RA++ +P + L DEPL+ LD +A++ I +L +R +YV+H Sbjct: 133 SGGEKQRVAIGRALLASPRILLMDEPLAALDPARKAEVLPFIAQLARRFSVPILYVSHSM 192 Query: 196 LEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFLSGTVQRQDGQLF 255 E + LAD + LM G++ +G P E +G P + L+G + Sbjct: 193 DEVLRLADTLALMDGGKVAASG-PLE-----------SLMGDPGLRPLTGRYEAGAVIGA 240 Query: 256 IETAH------QRWALTGERF----SRLRHAMAVKLAVRPDHVRIAGEREPAASLTCPVS 305 + ++H R A G S L V+L + V IA E S+ + Sbjct: 241 VVSSHDSGFGISRLAFDGGTLIVGRSELPVGAKVRLRIHARDVAIAIEPPDRVSIRNVLP 300 Query: 306 VELVEILGADALL 318 +V + AD+ L Sbjct: 301 AIVVSVAPADSFL 313 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 363 Length adjustment: 30 Effective length of query: 376 Effective length of database: 333 Effective search space: 125208 Effective search space used: 125208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory