Align Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH; EC 4.1.2.28 (characterized)
to candidate WP_043744492.1 AMB_RS12805 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P39359 (301 letters) >NCBI__GCF_000009985.1:WP_043744492.1 Length = 290 Score = 149 bits (376), Expect = 7e-41 Identities = 98/297 (32%), Positives = 157/297 (52%), Gaps = 9/297 (3%) Query: 4 FSGIIPPVSSTFHRDGTLDKKAMREVADFLINKGVDGLFYLGTGGEFSQMNTAQRMALAE 63 F G I + + F R+G +D+KA +++ + I +G + GT GE ++ + + E Sbjct: 2 FKGSITALITPF-RNGKVDEKAFQDLVAWQIAEGTHAVVPCGTTGESPTLSHDEHHRVVE 60 Query: 64 EAVTIVDGRVPVLIGVGSPSTDEAVKLAQHAQAYGADGIVAINPYYWKVAPRNLDDYYQQ 123 + + G+VPV+ G GS STDEAV L QHA+ GAD + + PYY K + L +++ Sbjct: 61 LCLEVARGKVPVIAGTGSNSTDEAVALTQHARKAGADAALVVAPYYNKPSQEGLFRHFEA 120 Query: 124 IARSVTLPVILYNFPDLTGQDLTPETVTRLALQNENIVGIKDTIDSVGHLRTMINTVKSV 183 IA+SV +P+I+YN P + D++ ET RL+ NI GIK D+ L + ++ Sbjct: 121 IAKSVDIPIIVYNIPGRSVIDISVETFVRLSAL-PNIAGIK---DATADLARPLRIRAAL 176 Query: 184 RPSFSVFCGYDDHLLNTMLLGGDGAITASANFAPELSVGIYRAWREGDLATAATLNKKLL 243 G D + GG G I+ ++N AP+L + AW GDLAT LNK L+ Sbjct: 177 DERLCQLSGEDATAIAFNAQGGVGCISVTSNIAPKLCARMQNAWAAGDLATCNELNKILM 236 Query: 244 QL-PAIYALETPFVSLIKYSMQCVGLPVETYCLPPILEASEEAKDKVHVLLTAQGIL 299 L A++ +P + +KY+ +G L P++ ASE A+ +V + A G++ Sbjct: 237 PLHDALFCETSP--APVKYAASLLGKSAPDVRL-PLVPASENARHRVEAAMKAAGLI 290 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 290 Length adjustment: 26 Effective length of query: 275 Effective length of database: 264 Effective search space: 72600 Effective search space used: 72600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory