Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate WP_011383893.1 AMB_RS07490 aldehyde oxidase
Query= metacyc::MONOMER-18073 (163 letters) >NCBI__GCF_000009985.1:WP_011383893.1 Length = 913 Score = 145 bits (367), Expect = 1e-39 Identities = 72/146 (49%), Positives = 96/146 (65%) Query: 14 VKVNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTLFAV 73 + +NG + V P L LRE+LGL GTK+GCD CGACTVL++G+SV SC + Sbjct: 6 LSINGTSHSLEVPPMRRLSKVLREDLGLRGTKVGCDAGDCGACTVLIDGESVCSCMIPVG 65 Query: 74 QADGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKENPNPSEEEV 133 + G EI T+EGLS + L +Q AF+ A QCG CTPGM+ A LL+ P PSE+EV Sbjct: 66 RLTGREIITVEGLSEGAALGRLQRAFEHFGAAQCGICTPGMLNAATALLRSRPRPSEDEV 125 Query: 134 RDGLHGNICRCTGYQNIVKAVLDASR 159 D + G +CRCTGY+ IV+AV+++ R Sbjct: 126 LDAIGGVLCRCTGYRKIVQAVVESHR 151 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 913 Length adjustment: 30 Effective length of query: 133 Effective length of database: 883 Effective search space: 117439 Effective search space used: 117439 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory