Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_011385004.1 AMB_RS13205 polyamine ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000009985.1:WP_011385004.1 Length = 379 Score = 209 bits (533), Expect = 8e-59 Identities = 120/276 (43%), Positives = 171/276 (61%), Gaps = 8/276 (2%) Query: 21 LKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGAIMIGDQDVSGMSPKDRDIA 80 +++++L+I +GEF L+G SGCGK+TL+ +AG E T G I+I QDV+ + P +R + Sbjct: 38 VEHVDLAIHKGEFFSLLGASGCGKTTLLRMLAGFEIPTTGRILIDGQDVTEVPPYERPVN 97 Query: 81 MVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVAKLLQIEHLLNRKPGQLSGGQ 140 M+FQSYAL+P MSV +NI FGLK + + I +VA +L+Q+ RKP QLSGGQ Sbjct: 98 MMFQSYALFPHMSVADNIAFGLKQDGLAKPVIKDKVAAALELVQMGRFSGRKPHQLSGGQ 157 Query: 141 QQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEAM 200 +QRVA+ R LA+ PK+ L DEPL+ LD KLR + E+ + R+ T V VTHDQ EAM Sbjct: 158 RQRVALARCLAKEPKVVLLDEPLAALDKKLREATQLELVNIQDRVGITFVMVTHDQGEAM 217 Query: 201 TLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPPMNFVPLRLQRKDGRLVALLD 260 T+ ++ VM G I+Q G+P +IY P +FVA FIG+ N ++ +G L Sbjct: 218 TMSSRIGVMNAGCIEQVGSPVDIYEYPGTRFVADFIGA--ANMFQGSVRGGEGALAIAC- 274 Query: 261 SGQARCELALNTTEAG--LEDRDVILGLRPEQIMLA 294 E L+ TEAG V + +RPE++M+A Sbjct: 275 ---PELEHDLSVTEAGAVAAGTPVTVMVRPEKVMIA 307 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 379 Length adjustment: 30 Effective length of query: 356 Effective length of database: 349 Effective search space: 124244 Effective search space used: 124244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory