Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_043745616.1 AMB_RS21885 ABC transporter
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000009985.1:WP_043745616.1 Length = 229 Score = 124 bits (312), Expect = 2e-33 Identities = 86/223 (38%), Positives = 120/223 (53%), Gaps = 13/223 (5%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 + +LE ++N AG + L I+L + GE L +VGPSG GKSTL+ +AGLE T G Sbjct: 11 LVSLEAVHLNLASLAGEVNVLDGIDLQVASGETLGVVGPSGSGKSTLLMVMAGLERPTSG 70 Query: 61 AIMIGDQDVS-----GMSPKDRD-IAMVFQSYALYPTMSVRENIEFGLKI--RKMPQADI 112 + + QD G++ RD I +VFQS+ L PTM+ EN+ L++ P Sbjct: 71 KVAVAGQDFGPMDEDGLARFRRDSIGIVFQSFHLIPTMTALENVAVPLELAGHADPFGAA 130 Query: 113 DAEVARVAKLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRV 172 E+ RV + H L+ PGQLSGG+QQRVA+ RA RPK+ L DEP NLD Sbjct: 131 QEELGRVG----LAHRLSHYPGQLSGGEQQRVALARAFVPRPKLLLADEPTGNLDGATGR 186 Query: 173 EMRTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQ 215 + + ++ R T V VTHD A +V ++DG I+ Sbjct: 187 AVMDLLFDLNARFGTALVLVTHDDSLAARC-TRVVRVEDGKIK 228 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 229 Length adjustment: 26 Effective length of query: 360 Effective length of database: 203 Effective search space: 73080 Effective search space used: 73080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory