Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate WP_011384008.1 AMB_RS08070 NAD(P)-dependent oxidoreductase
Query= uniprot:A0A4R8NY47 (263 letters) >NCBI__GCF_000009985.1:WP_011384008.1 Length = 245 Score = 63.9 bits (154), Expect = 3e-15 Identities = 65/248 (26%), Positives = 98/248 (39%), Gaps = 19/248 (7%) Query: 20 KRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALV-ASLKDAAVAPRFFPCNLM 78 K VV+TG GIG A+ F+ +G +V A P E ++ + VA P + Sbjct: 5 KTVVVTGASRGIGHAIARRFLAEGWRVITCARADVPKECMIDRNWACHIVADLADPASAQ 64 Query: 79 NLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAY------WDERLAVNLRHQF 132 + A + E + L+NNA + ++ W + +N Sbjct: 65 DFVAQANAWLGAEPLHA----LVNNAGVSPKTPYKERLGVLNGPIDGWKDVFELNFFAPL 120 Query: 133 FCAQAVLPGMRERKGGVILNFGSISWHLGLPDL-TLYMTAKAGIEGMTHGMARDFGRDGV 191 A+ + KG ++ N SI+ H P + Y T+KA + G+T MA + + GV Sbjct: 121 RLARGFASALHRGKGAIV-NITSIAGHYVHPFAGSAYSTSKAALSGLTREMAAEMAQLGV 179 Query: 192 RVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRVDPHDVAALALFLSSDSGAKCTG 251 RVNA+ PG IRT E ++ L P DVA L TG Sbjct: 180 RVNAVAPGEIRTEM------ISAEYEALVPRIPLERMGTPEDVAGTVFRLCGSDFDYVTG 233 Query: 252 REYYVDAG 259 E +V G Sbjct: 234 TEVFVTGG 241 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory