Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_011384549.1 AMB_RS10870 KR domain-containing protein
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_000009985.1:WP_011384549.1 Length = 235 Score = 99.4 bits (246), Expect = 6e-26 Identities = 80/240 (33%), Positives = 114/240 (47%), Gaps = 14/240 (5%) Query: 18 GKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVDLT 77 G+ +VTGG GIG I +G GA+V FD E L + ++A VD++ Sbjct: 7 GRVAVVTGGMRGIGRTIADGLLAGGAEVHVFDREAGE---LPQGMTAHA-------VDVS 56 Query: 78 DVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQAV 137 + S+ A A + K +LVNNA + ++++ W L+VNL F +A Sbjct: 57 NSDSVNAAFAAIGKPV---HLLVNNAGITRDRTLLKMSDEEWGSVLTVNLTSAFNTIRAA 113 Query: 138 VPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATCVIP 197 P M G G IVN+ SI+ G Y KA + GLT++ A++LG G+ V P Sbjct: 114 GPGMVQAGVGRIVNMISINGLRGKMGQGNYAASKAGMVGLTKTAAKELGSKGVTCNAVAP 173 Query: 198 GNVRTPRQLKWYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLVTGHSYFVDAG 257 G V T LK + + +A L D+A VLFL SD AR +TG VD+G Sbjct: 174 GMVLTEMTLK-LDQQFRDKALAEAALSILPDTTDIANAVLFLLSDAARCITGEVIKVDSG 232 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 235 Length adjustment: 24 Effective length of query: 235 Effective length of database: 211 Effective search space: 49585 Effective search space used: 49585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory