Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_011385057.1 AMB_RS13470 3-hydroxybutyrate dehydrogenase
Query= BRENDA::B8H1Z0 (248 letters) >NCBI__GCF_000009985.1:WP_011385057.1 Length = 260 Score = 110 bits (274), Expect = 4e-29 Identities = 80/256 (31%), Positives = 112/256 (43%), Gaps = 17/256 (6%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIAD-EDSRALEAELAGS-PIPPVYKR 66 L GKR ++TG SGIG G+ A QGA V+ D + AL A LA + +Y Sbjct: 2 LNGKRALVTGSTSGIGLGIARALAAQGASVMLNGFGDGAEIEALRAGLAKEFGVTVLYNG 61 Query: 67 CDLMNLEA----IKAVFAEIGDVDVLVNNAGNDDRHKLADVTGAYWDERINVNLRHMLFC 122 DL + ++ A +G VD+LVNNAG + + WD I +NL + Sbjct: 62 ADLSKPDGAGVLVRDAEARLGGVDILVNNAGIQHVSPVEEFPLERWDAVIAINLTSVFQA 121 Query: 123 TQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRVT 182 +A PGMK RG G +IN S + + Y +K G+ G+T+ + E D+ Sbjct: 122 IRAALPGMKARGWGRIINVASAHGLVASVNKSAYVASKHGVLGLTKVVGLETAETDVTCN 181 Query: 183 CVVPGNVKTKRQEKWYTPEGEAQIVAA-----------QCLKGRIVPENVAALVLFLASD 231 + PG V T +K EAQ V Q K PE + L +FL S Sbjct: 182 AICPGWVLTPLVQKQIDARAEAQGVPVEQAGRDLLSEKQPSKKFTTPEQIGDLAVFLCSG 241 Query: 232 DASLCTGHEYWIDAGW 247 + TG +D GW Sbjct: 242 AGANMTGTSLTMDGGW 257 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 260 Length adjustment: 24 Effective length of query: 224 Effective length of database: 236 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory