Align histidinol-phosphate aminotransferase; tyrosine/phenylalanine aminotransferase (promiscuous) (EC 2.6.1.1; EC 2.6.1.9) (characterized)
to candidate WP_013430740.1 CALKRO_RS09110 histidinol-phosphate transaminase
Query= metacyc::BSU22620-MONOMER (360 letters) >NCBI__GCF_000166775.1:WP_013430740.1 Length = 358 Score = 313 bits (801), Expect = 6e-90 Identities = 160/357 (44%), Positives = 223/357 (62%), Gaps = 1/357 (0%) Query: 4 KEHLKQLKPYQPGKPIEAVKSEYGLDKVVKLASNENPYGCSEAAKEALHHEIQQLALYPD 63 +E + + PY PGKPI VK E GL+KV+KLASNENP G SE K+AL + +L +YPD Sbjct: 3 REVINTISPYIPGKPISEVKRELGLEKVIKLASNENPLGPSENVKKALMQNLDELGIYPD 62 Query: 64 GYSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNAV 123 G L+ +LSK L V + ++ G GSDEI Q I F+N N + A P+FP+Y+ Sbjct: 63 GNCTELKLKLSKKLGVKPSQILLGAGSDEITQFIAAVFINPGDNAIMAKPSFPRYETVTK 122 Query: 124 IEGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVPS 183 + G E+ L+ D +HDL+A I+E+T+V+WIC+PNNPTGT EL F++ VPS Sbjct: 123 VMGGIPIELPLK-DFTHDLEAFYNNINERTKVIWICNPNNPTGTIVKRKELYDFIKSVPS 181 Query: 184 RVLVVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFSKAYGLAALRVGYGIADENLIR 243 + VV+D+AY EY+ +YP+ L ++ NL++L+TFSK YGLA+LR+GY IA E +I Sbjct: 182 HIAVVVDQAYKEYIDDPEYPDATEWLYEFENLIVLQTFSKIYGLASLRIGYAIASEEIIE 241 Query: 244 QIEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGLKCYPSQTN 303 ++ R PFN + L Q AA AALDD+ + E N L+ +Y + GL S N Sbjct: 242 KLNRVRPPFNVNHLAQIAASAALDDEEHVKKAKELNKKSLEFFYKNFEEMGLFYIKSYGN 301 Query: 304 FVLIDFKRPADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEILAILAEIL 360 FV++D K+ A ++F+ LL KG IVR G+ G PT LR+T G + N + L EIL Sbjct: 302 FVMVDVKKDAVDVFKKLLLKGIIVRPGDIFGMPTYLRVTTGQEGDNMGFIKALKEIL 358 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 358 Length adjustment: 29 Effective length of query: 331 Effective length of database: 329 Effective search space: 108899 Effective search space used: 108899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_013430740.1 CALKRO_RS09110 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.1936558.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-111 356.3 0.0 8.3e-111 356.2 0.0 1.0 1 NCBI__GCF_000166775.1:WP_013430740.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000166775.1:WP_013430740.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.2 0.0 8.3e-111 8.3e-111 1 349 [] 3 357 .. 3 357 .. 0.98 Alignments for each domain: == domain 1 score: 356.2 bits; conditional E-value: 8.3e-111 TIGR01141 1 rekikklepYqpg......arelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealaky 67 re i+ ++pY pg +relg ++v+kL+snEnP+gpse+vk+al ++l++l Ypd + +elk +l+k+ NCBI__GCF_000166775.1:WP_013430740.1 3 REVINTISPYIPGkpisevKRELGLEKVIKLASNENPLGPSENVKKALMQNLDELGIYPDGNCTELKLKLSKK 75 6889********************************************************************* PP TIGR01141 68 lgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaa 140 lgv++ +illg+Gsde+ ++++ f++pgd++++++p++ Ye+++k+ g +e plk+ ++dlea+++++ NCBI__GCF_000166775.1:WP_013430740.1 76 LGVKPSQILLGAGSDEITQFIAAVFINPGDNAIMAKPSFPRYETVTKVMGGIPIELPLKDF-THDLEAFYNNI 147 **********************************************************987.7********** PP TIGR01141 141 kekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlvvlrTlS 209 +e++k++++++PnnPtG+++kr+e+ +++++v ++ VVvD+AY e+ ++ ++++e+l e++nl+vl+T+S NCBI__GCF_000166775.1:WP_013430740.1 148 NERTKVIWICNPNNPTGTIVKRKELYDFIKSVpSHIAVVVDQAYKEYIDDpeyPDATEWLYEFENLIVLQTFS 220 ********************************88****************9999******************* PP TIGR01141 210 KafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleelkkleg 282 K++gLA+lR+Gyaia++eiie l++vr+p+nv+ la+ aa aal+d+++++k e +kk+ e +++++++ g NCBI__GCF_000166775.1:WP_013430740.1 221 KIYGLASLRIGYAIASEEIIEKLNRVRPPFNVNHLAQIAASAALDDEEHVKKAKELNKKSLEFFYKNFEEM-G 292 ***********************************************************************.8 PP TIGR01141 283 levyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerllealkei 349 l +++S++NFv+++vk+da +++++ll kgiivR + g+ +++lR+t+G++ +n +++alkei NCBI__GCF_000166775.1:WP_013430740.1 293 LFYIKSYGNFVMVDVKKDAVDVFKKLLLKGIIVRPGDIF-GM-PTYLRVTTGQEGDNMGFIKALKEI 357 ************************************988.96.*********************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.71 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory