Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_013430899.1 CALKRO_RS10015 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000166775.1:WP_013430899.1 Length = 256 Score = 167 bits (424), Expect = 2e-46 Identities = 92/259 (35%), Positives = 151/259 (58%), Gaps = 11/259 (4%) Query: 6 ASLARLTDVIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDV 65 AS L +++D L + CPWDK+QT ESL YL+EE +E++EAI + +++EE+GD+ Sbjct: 3 ASFEELVEIMDILRSK--CPWDKQQTHESLKKYLIEETYEVIEAIDEKDFTKLKEELGDL 60 Query: 66 MFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAE 125 + + F ++ + G F + + + + KM RRH HVF +++ +E L NW+ +K E Sbjct: 61 LLQVVFHAKIAQENGRFDIYEVIYDICQKMKRRHTHVFGSDSFSTAEEVLLNWDKVKNNE 120 Query: 126 KADAEGEPQGVYDS---LPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELL 182 K E + V DS +P LP L+++Y++ KAA+VGF W E +V E EL Sbjct: 121 K-----EIETVTDSMKRIPKHLPALMRSYKVQEKAAKVGFDWESYEGALNKVYEELKELK 175 Query: 183 DVLAGDDKAAQ-ENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERG 241 + L+ ++K + E E+GD++F++V + R + AL T KF+ RF +E A ++G Sbjct: 176 ECLSKNEKKEKIEEEIGDILFAVVNIARFFNVDPEEALHRTVKKFITRFSYIEESAFKQG 235 Query: 242 LDFPALSLDDKDELWNEAK 260 ++L+D D+ W EAK Sbjct: 236 KILNEMTLEDMDKFWEEAK 254 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 256 Length adjustment: 25 Effective length of query: 242 Effective length of database: 231 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory