Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_013429768.1 CALKRO_RS03695 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000166775.1:WP_013429768.1 Length = 409 Score = 345 bits (886), Expect = 2e-99 Identities = 187/400 (46%), Positives = 270/400 (67%), Gaps = 4/400 (1%) Query: 340 VVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENPD 399 +VV K+GG +++D E++ + A + I + G K VVV+SA GDTTD LIE AK I+ENP Sbjct: 3 IVVQKYGGTSVADKERIFRAARRAISEYEKGNKVVVVVSAQGDTTDELIEKAKEINENPS 62 Query: 400 PRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDIIS 459 RE+D+LLSTGE S+ALM++A+ K GY IS TG Q I TD Y +ARII+I+++ + Sbjct: 63 KREMDMLLSTGEQISIALMAMAIEKLGYPVISLTGWQAGIKTDSHYSNARIIEIDSERLQ 122 Query: 460 RYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTAD 519 R L + I VVAGFQGI + DITTLGRGGSD TA+ALA +L AD CE+Y DVDGVYTAD Sbjct: 123 RELDKRNIVVVAGFQGINKYDDITTLGRGGSDTTAVALAAALKADKCEIYTDVDGVYTAD 182 Query: 520 PRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLIWE 579 PRIV +A +KE+S++EM+EL+ GA+VL R+ E A+KY + ++++++ + GT++ E Sbjct: 183 PRIVPNASKLKEISYDEMLELATLGAKVLHNRSVELAKKYNIPLVVRSSFNDNEGTIVKE 242 Query: 580 GTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMKSGEYN 639 VE +V V + +A+V + V + PG A +I L++ +N+D+I+Q + + Sbjct: 243 VNSVEKLLVSGVACDKDIARVAVIGVENVPGKAFQIFSLLAKENINVDIILQSIGREKTK 302 Query: 640 TVAFIVPESQLGKLDIDLLKTRSE---AKEIIIEKGLAKVSIVGVNLTSTPEISATLFET 696 ++F V +S L K +D+L AK+I +AKVSIVG + + P ++A +FE Sbjct: 303 DISFTVSKSNL-KQTLDVLTKNLHIIGAKDITYADNVAKVSIVGAGMVNNPGVAAMMFEA 361 Query: 697 LANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFEL 736 L + GINI+MIS S +ISV+ID K E AV+AIH +F+L Sbjct: 362 LYDAGINIEMISTSEIKISVLIDEKDAEKAVRAIHDKFKL 401 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 754 Number of extensions: 39 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 409 Length adjustment: 36 Effective length of query: 703 Effective length of database: 373 Effective search space: 262219 Effective search space used: 262219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory