Align acetylornithine aminotransferase; EC 2.6.1.11 (characterized)
to candidate WP_010441020.1 G7G_RS0109975 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= CharProtDB::CH_124889 (441 letters) >NCBI__GCF_000192475.1:WP_010441020.1 Length = 1021 Score = 120 bits (302), Expect = 2e-31 Identities = 110/372 (29%), Positives = 168/372 (45%), Gaps = 45/372 (12%) Query: 44 GANIISVYARYPVVAAKGEGSYLFDKEGRKYIDFTSGVAVTSLGHAHPEVARLAADQCSK 103 G N+ Y PV+ +G +LFD+ GR Y+D + V +GHAHP + +AADQ + Sbjct: 588 GGNLSLTYDD-PVMLVRGWKHHLFDEWGRPYLDAYNNVP--HVGHAHPRIQAVAADQLKR 644 Query: 104 LVHSSNLFYNEPA-IELSNVINNSLAKNSGIAGPTKIFFANCGTEANETALKFARKAAFE 162 + +SN Y PA ++ I + L + + FF N GTEANE AL+ AR Sbjct: 645 M--NSNTRYLHPAQTAFADKILSKLPDHLEVC-----FFVNSGTEANELALRLARAHT-- 695 Query: 163 KYGEGKSQIVYFNNSFHGRSLGSLSITA----NPK----------------YKRGFQPLL 202 G IV ++ +HG + +++I+A P+ Y+ F+ Sbjct: 696 ----GAKGIVTPDHGYHGNTNAAVAISAYKFNKPRGVGQADWVELVEVANDYRGSFRRDD 751 Query: 203 PDVVQAVYN--DPASIE--QFVNDKTAAVIVEPVQGEGGICPAKPEFLIALRKACDKVGA 258 PD + + DPA IE Q A I E GG +L A+ + G Sbjct: 752 PDRARRFADLVDPA-IEALQAKGHGLAGFIAETFPSVGGQIIPPKGYLPAVYEKIRAAGG 810 Query: 259 SLIYDEIQCGLGRSGDLWAHSIVKDVASPDIITVAKPLANGLPIGATIVSSKIAAEIHPG 318 I DE+Q GLGR G+ + A PDI+ + KP+ NG P+G + + +IA G Sbjct: 811 VCIADEVQTGLGRLGEHY-FGFEHQGALPDIVVMGKPIGNGHPLGVLVTTKEIAQSFDNG 869 Query: 319 -EHGSTFGGNPVACRVGTFCVNELGSSKILQNVRKQHKALTSRFDDFVAKYPNLIRGYAG 377 E STFGG+ ++CR+G ++ + + +N R L A + + G Sbjct: 870 IEFFSTFGGSTLSCRIGKEVLDIVDDEGLQENARVMGARLMDGLRQIEADFA-CVGDVRG 928 Query: 378 RGLLLGLQFTEP 389 GL LG++ P Sbjct: 929 MGLFLGVELINP 940 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 882 Number of extensions: 56 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 1021 Length adjustment: 38 Effective length of query: 403 Effective length of database: 983 Effective search space: 396149 Effective search space used: 396149 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory