Align glycine hydroxymethyltransferase (EC 2.1.2.1) (characterized)
to candidate WP_010439643.1 G7G_RS0106265 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::Q9UWT5 (433 letters) >NCBI__GCF_000192475.1:WP_010439643.1 Length = 435 Score = 254 bits (648), Expect = 5e-72 Identities = 140/390 (35%), Positives = 212/390 (54%), Gaps = 6/390 (1%) Query: 24 QTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITN 83 + NL + NVM+P AE++ S SR + G P +Y G + ++IE + EL E+ + Sbjct: 50 ECFNLNPATNVMNPKAEALLSSGIGSRPSLGYPGDKYEMGMEAIEQIEVIAAELCAEVFD 109 Query: 84 SKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPF 143 ++ ++R SG IAN F + GD + P G HV+H G G G++ IE P Sbjct: 110 ARFAEVRVPSGAIANLYGFMATCKAGDTIIAPPGSIGGHVTHHAAGCAGLFGLRTIEAPV 169 Query: 144 DEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYG 203 + + VDVD+ + + +P+ + +GGSL LF HP E+ +GAK+++DAAH G Sbjct: 170 NADGYTVDVDQLRALAKTERPRLITIGGSLNLFEHPVAEVRAIADEIGAKVMFDAAHQCG 229 Query: 204 LIEGKVWSNPLKDGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSKTIFPWFVSNHHLH 263 +I G+ WSNPLK+GA MT+ST+K+ GP GG I +D E+ K + FP +N Sbjct: 230 IIAGRAWSNPLKEGAHFMTMSTYKSLGGPAGGLIVTDDEEIAKALDAIAFPGMTANFDAA 289 Query: 264 RLPATAVTAIEMKYFGESYANQILRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQ 323 + A AVT ++ K FG +YAN+++ +KAL+ AL +G V G+T SHQ AV Sbjct: 290 KTAALAVTMLDWKAFGSAYANEMIAMAKALSNALDTKGVPVFSGTRGFTNSHQFAVLAAP 349 Query: 324 FGGGNKIAKLLEDANIIVNKNLLPYDKPEDVSDPSGLRIGVQEMTRYGMKEGEMEEIAEL 383 +GGG +K L + LP + E D +GLRIG E+ R+GM G+ E +A L Sbjct: 350 YGGGQAASKQLRKCGFLACGIGLPVELVE--GDMNGLRIGTPELVRWGMTSGDAERLANL 407 Query: 384 FKKVIIDKKDVNEVKKEVIEMRRNFLEVKY 413 + + +++ EV RR F + Y Sbjct: 408 IMRGL----GGEQIQSEVSAWRREFDTLHY 433 Lambda K H 0.316 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 433 Length of database: 435 Length adjustment: 32 Effective length of query: 401 Effective length of database: 403 Effective search space: 161603 Effective search space used: 161603 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory