Align serine hydroxymethyltransferase subunit (EC 2.1.2.1) (characterized)
to candidate WP_010443719.1 G7G_RS0122205 serine hydroxymethyltransferase
Query= metacyc::MONOMER-4244 (434 letters) >NCBI__GCF_000192475.1:WP_010443719.1 Length = 251 Score = 394 bits (1012), Expect = e-114 Identities = 192/251 (76%), Positives = 215/251 (85%) Query: 52 SQAVLDAAGSVLTNKYAEGYPGKRYYGGCQYVDIVEDIAIDRAKKLFNCEFANVQPNSGS 111 S AV++A GSV+TNKYAEGYPG+RYYGGC++VDI E++AIDRA++LF C FANVQPNSGS Sbjct: 1 SAAVMEAQGSVMTNKYAEGYPGRRYYGGCEFVDIAENLAIDRARQLFGCGFANVQPNSGS 60 Query: 112 QANQGVFNALAQPGDTILGLSLAAGGHLTHGAPVNQSGKWFKAVHYMVKPDSHLIDMDEV 171 QANQGVF AL QPGDTILG+SL AGGHLTHGA NQSGKWF AV Y V+ + +++D D+V Sbjct: 61 QANQGVFQALIQPGDTILGMSLDAGGHLTHGARPNQSGKWFNAVQYGVRKEDNMLDYDQV 120 Query: 172 RKLAQEHKPRIIIAGGSAYPRKIDFAAFRAIADEVGAIFLVDMAHFAGLVAAGLIPSPFP 231 LA+EH+P++IIAGGSA PR IDFA R IAD VGA VDMAH AGL+AA PSPFP Sbjct: 121 EALAKEHQPKLIIAGGSAIPRIIDFARMREIADMVGAYLHVDMAHIAGLIAASEHPSPFP 180 Query: 232 HAHVVTTTTHKTLRGPRGGMILTNDADIAKKINSAIFPGIQGGPLMHVIAGKAVAFGEAL 291 HAHV TTTTHKTLRGPRGGMILTND IAKK+NSAIFPGIQGGPLMHVIAGKAVAFGEAL Sbjct: 181 HAHVATTTTHKTLRGPRGGMILTNDEAIAKKVNSAIFPGIQGGPLMHVIAGKAVAFGEAL 240 Query: 292 RPDFKVYIKQV 302 RP FK YIKQV Sbjct: 241 RPSFKDYIKQV 251 Lambda K H 0.319 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 251 Length adjustment: 28 Effective length of query: 406 Effective length of database: 223 Effective search space: 90538 Effective search space used: 90538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory