Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_010443480.1 G7G_RS0121165 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000192475.1:WP_010443480.1 Length = 429 Score = 187 bits (475), Expect = 6e-52 Identities = 131/412 (31%), Positives = 208/412 (50%), Gaps = 24/412 (5%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P+ I +GEG+ ++D DG + D + V +VGH +PRVV+AI +QA + T + + Sbjct: 27 PVHIVKGEGVWLWDADGRKYLDCYNNVP--HVGHCNPRVVDAICRQANTLNTH--TRYLH 82 Query: 97 ENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQ 156 + + EKL ++ ++ +G+EAN+ A+++ + TG++ +A +HG T Sbjct: 83 DGILDYVEKLTSTVDDHLDTAILTC-TGSEANDIALRMAESMTGKRGIIATDATYHGNTS 141 Query: 157 AVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVF 216 V L+ S V GF G+ +R D Y PD R + + E + Sbjct: 142 LVSQLSKSN-VPTVGF-----GLGQF-----FRFVGAPDSYRNPDPEGMRFAESVAEQIA 190 Query: 217 RHVPPH-EIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGK- 274 H A+ P G+ P G+ K + + G LL DEVQ G GRTG Sbjct: 191 EHEKSGIGFAALVVCPYFLNEGFPDNPDGWLKPTAEVVRKAGGLLICDEVQSGFGRTGTH 250 Query: 275 FWAIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADI--TFDKPGRHATTFGGNPVAIAAGI 332 WA + GV PD++ GK +G G P+ GV+ ++I TF K R+ TFGGNPV+ AA I Sbjct: 251 MWAHQKMGVVPDVMTLGKPMGNGHPIGGVVTNSEILGTFRKGYRYFNTFGGNPVSCAAAI 310 Query: 333 EVVEIV--KELLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKY 390 V+E + K LL + ++VG + + +K+E IGD RG GL E+V +ETK+ Sbjct: 311 AVLEEIEDKHLLENARKVGAHARMRITRLAKKHEFIGDVRGSGLIFGAEMVLDRETKQPA 370 Query: 391 PELRDRIVKESAKRGLV--LLGCGDNSIRFIPPLIVTKEEIDVAMEIFEEAL 440 DR++ +RG++ LG N+++ PP+ + E D+ + +E L Sbjct: 371 SAFTDRVINGMRERGVIHSKLGRHKNTLKIRPPMPFSIENADLLFDTLDEVL 422 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 429 Length adjustment: 32 Effective length of query: 413 Effective length of database: 397 Effective search space: 163961 Effective search space used: 163961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory