Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate WP_009123459.1 HMPREF9446_RS00435 3-isopropylmalate dehydratase small subunit
Query= uniprot:A0A1X9Z766 (195 letters) >NCBI__GCF_000195635.1:WP_009123459.1 Length = 199 Score = 243 bits (621), Expect = 1e-69 Identities = 120/193 (62%), Positives = 143/193 (74%), Gaps = 2/193 (1%) Query: 2 KKFTKLTSAVVPLNIENIDTDQIIPARFLKATTREG--FGENLFRDWRYENDNQPKADFV 59 +KF +TS VPL +EN+DTDQIIPARFLKATTRE FG+NLFRDWRY D DFV Sbjct: 3 QKFNIITSTCVPLPLENVDTDQIIPARFLKATTREEKFFGDNLFRDWRYHPDGSLNKDFV 62 Query: 60 MNNPTYSGQVLVAGKNFGCGSSREHAAWAIQDAGFDAVISSFFADIFKGNALNNGLLPIQ 119 +NNPTY GQ+LVAGKNFG GSSREHAAWAI GF V+SSFFADI K N LNN +LP+ Sbjct: 63 LNNPTYGGQILVAGKNFGSGSSREHAAWAIAGYGFRVVVSSFFADIHKNNELNNFVLPVV 122 Query: 120 VSDEFLAQIFKAVDNNPKSALEVDLENQTVTIVETGAQESFEINPYKKSCLINGYDDIDF 179 VS+ FL ++F ++ +PK +EVDL QT+T TG E FEIN YKK CL+NG DDIDF Sbjct: 123 VSEPFLKELFDSISADPKMEVEVDLPQQTITNKATGKSEPFEINAYKKHCLMNGLDDIDF 182 Query: 180 ILNQKQLIEEFEE 192 ++ K IE +E+ Sbjct: 183 LVENKDKIETWEK 195 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 199 Length adjustment: 20 Effective length of query: 175 Effective length of database: 179 Effective search space: 31325 Effective search space used: 31325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_009123459.1 HMPREF9446_RS00435 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.1735401.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-58 181.4 0.1 8.8e-58 181.3 0.1 1.0 1 NCBI__GCF_000195635.1:WP_009123459.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000195635.1:WP_009123459.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.3 0.1 8.8e-58 8.8e-58 3 188 .] 4 190 .. 1 190 [. 0.93 Alignments for each domain: == domain 1 score: 181.3 bits; conditional E-value: 8.8e-58 TIGR00171 3 efkkltGlvvpldkanvdtdaiipkqflkkikrtG..fgkhlfyewryldekGkepnpefvlnvpqyqgasil 73 +f t +vpl nvdtd+iip +flk+ +r fg +lf +wry +G + n +fvln p+y +il NCBI__GCF_000195635.1:WP_009123459.1 4 KFNIITSTCVPLPLENVDTDQIIPARFLKATTREEkfFGDNLFRDWRY-HPDG-SLNKDFVLNNPTYG-GQIL 73 477788999**********************9964449**********.5667.79***********5.68** PP TIGR00171 74 larenfGcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkltvd 145 +a++nfG Gssreha wa++ yGf+v+++ fadi nn ++n +lp+ +se ++el+ ++ ++ ++++vd NCBI__GCF_000195635.1:WP_009123459.1 74 VAGKNFGSGSSREHAAWAIAGYGFRVVVSSFFADIHKNNELNNFVLPVVVSEPFLKELFDSISaDPKMEVEVD 146 **************************************************************989999***** PP TIGR00171 146 leaqkvkd.segkvysfeidefrkhcllnGldeigltlqkedei 188 l++q++++ + gk fei++++khcl+nGld+i + + ++d+i NCBI__GCF_000195635.1:WP_009123459.1 147 LPQQTITNkATGKSEPFEINAYKKHCLMNGLDDIDFLVENKDKI 190 ******862578***********************999999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (199 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.33 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory