Align 3-isopropylmalate dehydratase small subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate WP_009124399.1 HMPREF9446_RS05240 aconitate hydratase
Query= curated2:O29626 (161 letters) >NCBI__GCF_000195635.1:WP_009124399.1 Length = 747 Score = 47.4 bits (111), Expect = 5e-10 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 3/68 (4%) Query: 52 VVAGENFGCGSSREHAPLALKATGIEAVIAKSYARIFFRNAINIGLRVL---ECKETDKI 108 VVA EN+G GSSREHA + + + ++AKS+ARI N G+ L + + DKI Sbjct: 631 VVAEENYGEGSSREHAAMEPRFLNVRVILAKSFARIHETNLKKQGMLALTFADKADYDKI 690 Query: 109 EDGDELEV 116 ++ D L V Sbjct: 691 QEHDLLSV 698 Lambda K H 0.317 0.140 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 161 Length of database: 747 Length adjustment: 28 Effective length of query: 133 Effective length of database: 719 Effective search space: 95627 Effective search space used: 95627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory