Align O-acetyl-L-homoserine sulfhydrylase; OAH sulfhydrylase; O-acetylhomoserine thiolase; EC 2.5.1.- (characterized)
to candidate WP_039968458.1 HMPREF9446_RS03830 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= SwissProt::Q9WZY4 (430 letters) >NCBI__GCF_000195635.1:WP_039968458.1 Length = 430 Score = 479 bits (1234), Expect = e-140 Identities = 243/431 (56%), Positives = 302/431 (70%), Gaps = 3/431 (0%) Query: 1 MDWKKYGYNTRALHAGYEPPEQATGSRAVPIYQTTSYVFRDSDHAARLFALEEPGFIYTR 60 M+ KK + T LH G E P+ AT +RAVPIYQTTSYVFRDS HAA F L++PG IY R Sbjct: 1 METKKLHFETLQLHVGQEQPDPATDARAVPIYQTTSYVFRDSAHAAARFGLQDPGNIYGR 60 Query: 61 IGNPTVSVLEERIAALEEGVGALAVASGQAAITYAILNIAGPGDEIVSGSALYGGTYNLF 120 + N T V E+R+AALE GV LAVASG AA+TYA NIA GD IV+ +YGGTYNL Sbjct: 61 LTNSTQEVFEKRVAALEGGVAGLAVASGAAAVTYAFENIARAGDHIVAAKTIYGGTYNLL 120 Query: 121 RHTLYKKSGIIVKFVDETDPKNIEEAITEKTKAVYLETIGNPGLTVPDFEAIAEIAHRHG 180 HTL GI FVD D N E+AI E TKA+++ET+GNP + D +A+A IAHRH Sbjct: 121 AHTL-PAYGITTTFVDPADLDNFEKAIRENTKAIFIETLGNPNCNIIDIDAVAGIAHRHK 179 Query: 181 VPLIVDNTVA-PYIFRPFEHGADIVVYSATKFIGGHGTSIGGLIVDSGKFDWT-NGKFPE 238 +PLIVDNT PY+ RP EHGADIVV+SATKFIGGHGTS+GG+I+D GKFDW +GKFP+ Sbjct: 180 IPLIVDNTFGTPYLVRPIEHGADIVVHSATKFIGGHGTSLGGVIIDGGKFDWVASGKFPQ 239 Query: 239 LVEPDPSYHGVSYVETFKEAAYIAKCRTQLLRDLGSCMSPFNAFLFILGLETLSLRMKKH 298 L EPDPSYHGV +V+ AAY + R LLRD G+ +SPFNAF+ + GLETLSLR+++H Sbjct: 240 LTEPDPSYHGVRFVDAAGPAAYAVRIRAILLRDTGAAISPFNAFILLQGLETLSLRVERH 299 Query: 299 CENALKIVEFLKSHPAVSWVNYPIAEGNKTRENALKYLKEGYGAIVTFGVKGGKEAGKKF 358 ENALK+V FL HP V+ VN+P + KY G G+I TF VKGG + + F Sbjct: 300 VENALKVVGFLSGHPKVAAVNHPSLPEHPDHALYQKYFPNGGGSIFTFEVKGGVKEAQTF 359 Query: 359 IDSLTLISHLANIGDARTLAIHPASTTHQQLTEEEQLKTGVTPDMIRLSVGIEDVEDIIA 418 ID L + S LAN+ D ++L IHPA+TTH QL E E + G+ P +RLS+G E ++D++ Sbjct: 360 IDHLQIFSLLANVADVKSLVIHPATTTHSQLNERELAEQGIKPGTVRLSIGTEHIDDLLE 419 Query: 419 DLDQALRKSQE 429 DL QAL K Q+ Sbjct: 420 DLSQALDKIQK 430 Lambda K H 0.317 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 430 Length adjustment: 32 Effective length of query: 398 Effective length of database: 398 Effective search space: 158404 Effective search space used: 158404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory