Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate WP_010528856.1 GQW_RS0115955 shikimate dehydrogenase
Query= reanno::Btheta:353741 (248 letters) >NCBI__GCF_000220155.1:WP_010528856.1 Length = 248 Score = 284 bits (727), Expect = 1e-81 Identities = 147/249 (59%), Positives = 184/249 (73%), Gaps = 3/249 (1%) Query: 1 MEKYGLIGYPLRHSFSIGYFNEKFRSEGINAEYVNFEIPNINDFMEVIEENPNLCGLNVT 60 M+ +GLIGYPL HSFS YF EKF+ E I+A Y+NF IP IN+ ++++++P L GLNVT Sbjct: 1 MQTFGLIGYPLGHSFSQSYFTEKFKKENIDARYLNFPIPEINELPDLLKKHPYLAGLNVT 60 Query: 61 IPYKEQVIPFLNELDRDTAKIGAVNVIKIIRQPKGKVK-LVGYNSDIIGFTQSIQPLLQP 119 IPYK+QVI +L+ELD IGAVNVIKI K KV L GYNSD+IGF++SI PLL+P Sbjct: 61 IPYKQQVIDYLDELDPQAKDIGAVNVIKITW--KNKVPYLKGYNSDVIGFSRSITPLLKP 118 Query: 120 QHKKALILGTGGASKAVYHGLKNLGIESVFVSRTHKTDDMLTYEELTPEIMEEYTVIVNC 179 H KALILGTGGASKAV + LK LG+ FVSR + ++Y+ LTPEI++EY VI+N Sbjct: 119 LHTKALILGTGGASKAVAYALKQLGLLFRFVSRNPQHPSHVSYQALTPEIIKEYKVIINT 178 Query: 180 TPVGMYPKVDFCPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAVTKNGLEMLLLQA 239 TP+GM P D P IPYE +T HL +DL+YNP TLF+ K +GAV KNGLEML LQA Sbjct: 179 TPLGMAPNTDVAPPIPYEGITQEHLAFDLIYNPETTLFLNKCANKGAVIKNGLEMLHLQA 238 Query: 240 FAAWEIWHR 248 AAWEI+++ Sbjct: 239 EAAWEIFNQ 247 Lambda K H 0.320 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 248 Length adjustment: 24 Effective length of query: 224 Effective length of database: 224 Effective search space: 50176 Effective search space used: 50176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory