Align chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_010528794.1 GQW_RS0115590 chorismate mutase
Query= reanno::Pedo557:CA265_RS11635 (379 letters) >NCBI__GCF_000220155.1:WP_010528794.1 Length = 369 Score = 404 bits (1037), Expect = e-117 Identities = 197/342 (57%), Positives = 254/342 (74%), Gaps = 1/342 (0%) Query: 20 PLIISGPCSAETEEQLLTTAHLLAATGKVSVLRAGIWKPRTRPGEFEGIGSIGLEWLKRA 79 P+IISGPCSAETEEQ L TA L+A G + + RAGIWKPRTRPG FEG+G++GL WLKR Sbjct: 19 PIIISGPCSAETEEQTLNTAKELSARG-IKIFRAGIWKPRTRPGAFEGVGTVGLPWLKRV 77 Query: 80 KAETGLPTAVEVANAKHVEEALAAGVDILWIGARSTVNPFTVQEIADALKGHDVPVLIKN 139 K ETG+ VEVA + HV EA+ GVD++WIGAR++ NPF VQEIADALKG D+PV++KN Sbjct: 78 KEETGMFICVEVATSHHVYEAVKFGVDMVWIGARTSANPFAVQEIADALKGLDMPVMVKN 137 Query: 140 PVNPDLQLWIGAIERINGAGITKIGAIHRGFSSFEKSSFRNEPMWELAIQLKTLCPELPI 199 PVNPDL+LWIGA+ER+N AGIT++ AIHRGFSS+++S FRN P W++ I+L+ PELPI Sbjct: 138 PVNPDLELWIGALERLNRAGITRLAAIHRGFSSYDQSEFRNNPQWQIPIELRRRIPELPI 197 Query: 200 INDPSHICGNRELIPYISQKALDLDMQGLMIESHVDPSVAWTDAKQQVTPAALAELVDRL 259 I DPSHI GNREL+ I+Q+A+DL+ GL+IESH+ P AW+DAKQQVTP L E++D L Sbjct: 198 ITDPSHIGGNRELLAGIAQEAMDLNFDGLIIESHICPDKAWSDAKQQVTPEMLKEILDNL 257 Query: 260 TVREPEAPNEAFADKLADLRKSIDKIDDVLLQKLGERMAIVEKIGEFKRDNQVTILQVNR 319 +R P+ + L +LRK ID++DD LL L ERM I E IG++K +N +TILQ R Sbjct: 258 VLRRPKIGEDTPRVTLDELRKQIDQLDDQLLDLLKERMKISEAIGKYKFENNITILQTRR 317 Query: 320 WDAIIKKGHAFAKALKLDLNFTEKFLELVHGESIRKQTEIMN 361 +D ++ L+ +F K E +H ESI +Q+EIMN Sbjct: 318 YDEVLNNRRERGSQRGLNEDFITKIFESIHEESINRQSEIMN 359 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 369 Length adjustment: 30 Effective length of query: 349 Effective length of database: 339 Effective search space: 118311 Effective search space used: 118311 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory