Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate WP_010526925.1 GQW_RS0104980 shikimate kinase
Query= uniprot:AROK_BACTN (175 letters) >NCBI__GCF_000220155.1:WP_010526925.1 Length = 173 Score = 144 bits (362), Expect = 1e-39 Identities = 67/147 (45%), Positives = 102/147 (69%) Query: 4 IFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELERNM 63 I+LTG+MG+GKTT G+ A+ LN FIDLD +IE++ ++ ++F++ GE FR+LE + Sbjct: 5 IYLTGFMGSGKTTFGRLLAKHLNREFIDLDHFIEQQEGVSISQIFSDLGEDEFRKLEHKV 64 Query: 64 LHEVAEFENVVISTGGGAPCFYDNMEFMNRTGKTVFLNVHPDVLFRRLRIAKQQRPILQG 123 L + N VI+TGGG PC+++NM+FMN G T++L V+ + L RL AK RP++ Sbjct: 65 LLSTVDKTNAVIATGGGTPCYFNNMDFMNNHGTTIYLKVNVEDLVNRLLPAKNHRPLIAD 124 Query: 124 KEDDELMDFIIQALEKRAPFYTQAQYI 150 KE+ EL +FI + L +RAP+Y +A+ I Sbjct: 125 KEESELREFISRKLSERAPYYNKAKII 151 Lambda K H 0.324 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 175 Length of database: 173 Length adjustment: 19 Effective length of query: 156 Effective length of database: 154 Effective search space: 24024 Effective search space used: 24024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory