Align Serine O-acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate WP_010526168.1 GQW_RS0100790 homoserine O-succinyltransferase
Query= SwissProt::A0A120HUS7 (271 letters) >NCBI__GCF_000220155.1:WP_010526168.1 Length = 302 Score = 145 bits (366), Expect = 1e-39 Identities = 80/259 (30%), Positives = 135/259 (52%), Gaps = 3/259 (1%) Query: 5 PLKIGILNVMHDKADTKTRLQHVLTHTAIPVDLHFYYPMTHYAGRTVPEAVSSILDPLDI 64 PL+I ILN+M K T+T L VL++T + V++ TH T + + S D Sbjct: 35 PLRILILNLMPLKIKTETHLLRVLSNTPLQVEVELLITSTHTPKNTPSQHLISFYKTFDE 94 Query: 65 HEVATMDGFIITGSPIETLEFDQVHYIAEVRTLLKTLSQHVPNQLYLCWGGMVALNYFFG 124 + DGFIITG+P+E L+F++V Y E++ ++ HV + L++CWG L + +G Sbjct: 95 IKGKNYDGFIITGAPVELLDFEKVTYWNELQKIMDWSKTHVTSTLHICWGAQAGLYHHYG 154 Query: 125 ISKLILPHKLFGVYPQTILEP-HPLLKGLKNDFKSPHARYAEMDVRGIHADPRLTINATT 183 I K LP KLFGV+ + +P PL++G + F +PH+RY E+ I L + A + Sbjct: 155 IPKHELPAKLFGVFEHFVYDPTEPLVRGFDDLFWAPHSRYTEVRKEDIEKVDNLILLADS 214 Query: 184 TKGKLFMVTEPTDTQTFVFSHIEYDRWGLDSEYKREVAAHPEIDYVRAKHYYHHKNDYDH 243 + +++ +Q F+ H EYD+ L EY+R+ + K+YY + + Sbjct: 215 EEAGPYIILSKDRSQVFITGHPEYDKLTLGEEYQRD--QKKGLSTAIPKNYYLNDDPSKE 272 Query: 244 PKFNWKKTQRTIFDNWIQH 262 W+ + ++ NW+ + Sbjct: 273 AVVRWRSHAQLLYSNWLNY 291 Lambda K H 0.322 0.138 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 302 Length adjustment: 26 Effective length of query: 245 Effective length of database: 276 Effective search space: 67620 Effective search space used: 67620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory