Align imidazole glycerol-phosphate synthase (EC 4.3.2.10) (characterized)
to candidate WP_010527312.1 GQW_RS0107125 imidazole glycerol phosphate synthase subunit HisF
Query= BRENDA::Q9SZ30 (592 letters) >NCBI__GCF_000220155.1:WP_010527312.1 Length = 251 Score = 144 bits (364), Expect = 3e-39 Identities = 106/314 (33%), Positives = 155/314 (49%), Gaps = 66/314 (21%) Query: 280 LAKRVIACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEIS 339 L+KR+I CLD+R KG ++ +++ +G PV+L Y + GADE+ Sbjct: 2 LSKRIIPCLDIRNGK-----TVKGVKF--------LDIKEVGDPVELGALYARQGADELV 48 Query: 340 FLNITGFRDF--PLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEY 397 FL+IT + DL VLR ++++ +P TVGGGI + DA Sbjct: 49 FLDITASHEKRKTFADL----VLR-IAQHINIPFTVGGGISELKDAE-----------IL 92 Query: 398 FRSGADKISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPD 457 +GADKISI S AV + + +++ +G+Q VVV+ID ++V Sbjct: 93 LNAGADKISINSSAVRNPQ------------LISDMAKHFGSQFVVVAIDAKQV------ 134 Query: 458 DVPYKVIRVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCD 517 E+ W TV+GGR F A+ E+ GAGEIL +D D Sbjct: 135 ----------------EDDDWV-VTVNGGRIPTEKRLFSWAREAEDRGAGEILFTSMDHD 177 Query: 518 GQGKGFDIDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQ 577 G KGF + + +S+ + IP+IAS GAG +HF +VF A A LAA IFH E+PI Sbjct: 178 GVKKGFANEALARLSEELSIPIIASGGAGAKEHFKDVFTIGKADAGLAASIFHFNEIPIP 237 Query: 578 SVKEHLQEERIEVR 591 +K++L+ I VR Sbjct: 238 ELKDYLRSHNIPVR 251 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 592 Length of database: 251 Length adjustment: 30 Effective length of query: 562 Effective length of database: 221 Effective search space: 124202 Effective search space used: 124202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory