Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate WP_029626527.1 GQW_RS0105435 inositol monophosphatase
Query= reanno::Phaeo:GFF2154 (250 letters) >NCBI__GCF_000220155.1:WP_029626527.1 Length = 267 Score = 80.5 bits (197), Expect = 3e-20 Identities = 65/215 (30%), Positives = 103/215 (47%), Gaps = 13/215 (6%) Query: 29 DPVTIADRAAEQAMRSVLSELRPEDSILGEEFGETHGQSGR--TWVLDPIDGTRGFISGT 86 D VT D+A+EQ + L L PE + EE +T + G+ W++DPIDGT FI G Sbjct: 40 DFVTQIDKASEQKLVEALGNLLPEAGFIAEE--KTSDKVGKKFNWIIDPIDGTTNFIHGL 97 Query: 87 PTWGVLIALGDADGPFLGIVDQPYIGERFIGTPEG-ASLTGPLGHSALVTRATDSLSEAT 145 + + IAL + D LG+V + + E F + A L G H + DSL Sbjct: 98 FPYAISIALQEDDQIVLGVVYEMGLDECFYSWKDAPAFLNGEEIHVSKTPTVADSL---- 153 Query: 146 LFTTFPEVGTEAERAAFQRVSAQVR----LTRYGMDCYAYALLAAGQCDLVIEAGLNAYD 201 + T FP + + + ++ ++ L R G A +A G+ D E L A+D Sbjct: 154 IATGFPYSNYQLIQNFMETLTFFMKNSHGLRRLGSAAVDLAYVACGRFDAFYEYNLKAWD 213 Query: 202 IQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATA 236 + A ++Q AGG V++++G + G+ L + A Sbjct: 214 VAAGAFLVQQAGGKVSDFKGGNNYLFGRELVSGNA 248 Lambda K H 0.317 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 267 Length adjustment: 24 Effective length of query: 226 Effective length of database: 243 Effective search space: 54918 Effective search space used: 54918 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory