Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_010527681.1 GQW_RS0109190 homoserine dehydrogenase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000220155.1:WP_010527681.1 Length = 399 Score = 146 bits (368), Expect = 2e-39 Identities = 97/314 (30%), Positives = 173/314 (55%), Gaps = 18/314 (5%) Query: 18 RKVRVGIAGLGTVGGSIYRILKERGNEIEKRIGEKFIISKVINRSPQKYELLGVPKEEIA 77 +K+ +G+ G G VG +Y +LK + ++ ++ EK + + I RS +P+ Sbjct: 4 QKLTLGLFGFGVVGQGLYDVLK-KSPALDVKV-EKICVKRKIKRS--------LPEHFFC 53 Query: 78 FDFDDLILNSDV--VVEAIGGTDVAVDLVRRALELGRIVVTPNKNLISEYGNEFSEYIKK 135 ++ DD++ N + +VE I D A +V++AL G+ VV+ NK +++E E K+ Sbjct: 54 YNPDDILENDRINTIVELIDNADEAYFIVKKALLKGKNVVSANKKMLAENLAELVSLAKE 113 Query: 136 RK--LFFEASVGGGIPIISLLQDYLIFQKVTRIRGIMNGTTNYILTEM-SKGRHFEEVLK 192 + L +EAS G IP+I L++Y + + GI+NG++NYIL+++ + +EE LK Sbjct: 114 KNVSLLYEASACGSIPVIRNLEEYYDNDLLLSVTGILNGSSNYILSKIFDNNQSYEEALK 173 Query: 193 EAQELGYAEADPTNDIEGYDVAYKVSVLAGVVTGRFPGINSVQFEGITRIDPEYLKEIVR 252 EAQ LG+AE++P+ D++G+D YK+ +L G N V GI+ I + Sbjct: 174 EAQNLGFAESNPSFDVDGFDSLYKLIILTMHSFGVIVPPNDVLNYGISNISDFDINFAKE 233 Query: 253 SGKKLKLIGELDFSTNR---YEVRLREVTPEDPFFNVDGVDNAIEVSTDLAGDFLLKGRG 309 G K+KL+G+++ ++ V R V+ + ++V+ N + + + G+G Sbjct: 234 KGYKIKLVGQVERLHDKKITLFVLPRFVSKDKYIYSVEDEFNGVVIKGLAYDKQFMFGKG 293 Query: 310 AGGYPTASAVIADL 323 AGG+PT SAV++D+ Sbjct: 294 AGGHPTGSAVLSDI 307 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 650 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 399 Length adjustment: 35 Effective length of query: 704 Effective length of database: 364 Effective search space: 256256 Effective search space used: 256256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory