Align Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 (characterized)
to candidate WP_010529220.1 ON01_RS01390 aconitate hydratase
Query= SwissProt::Q58667 (170 letters) >NCBI__GCF_000224785.1:WP_010529220.1 Length = 651 Score = 79.7 bits (195), Expect = 9e-20 Identities = 58/177 (32%), Positives = 93/177 (52%), Gaps = 25/177 (14%) Query: 9 KFGDDVDTDAIIPG-----PYLRTTDPYELASHCMAGIDENFPKKVKE-----GDVIVAG 58 K D++ TD I+ G PY R+ P E++ ID+ + K+ K G IV G Sbjct: 475 KMDDNISTDEILAGGARVLPY-RSNLP-EISKFTFEIIDDTYYKRGKATVDDGGHAIVGG 532 Query: 59 ENFGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINVGLIPII----ANTDEIKDGD 114 N+G GSSRE A +A ++ G++ + K FARI ++N +N G++P+ A+ D + GD Sbjct: 533 YNYGQGSSREHAALAPRFLGLRVALVKDFARIHWQNLVNFGVLPLTFVNEADYDLLSSGD 592 Query: 115 IVEI-DLDKE-----EIVITNKNKTIKCETPKGLER---EILAAGGLVNYLKKRKLI 162 ++ + DL + E I K+K + GL EI+ GG++N+ K R+ I Sbjct: 593 VLVLSDLRNKIQQGNEFSIDVKDKNEQINVQHGLSERQIEIMLKGGIINWAKDRQQI 649 Lambda K H 0.318 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 651 Length adjustment: 28 Effective length of query: 142 Effective length of database: 623 Effective search space: 88466 Effective search space used: 88466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory