Align Phosphoserine phosphatase RsbX; EC 3.1.3.3; Sigma-B negative effector (uncharacterized)
to candidate WP_010529418.1 ON01_RS02385 SpoIIE family protein phosphatase
Query= curated2:P17906 (199 letters) >NCBI__GCF_000224785.1:WP_010529418.1 Length = 199 Score = 132 bits (333), Expect = 3e-36 Identities = 68/193 (35%), Positives = 109/193 (56%), Gaps = 2/193 (1%) Query: 4 VEENEHIQTLVYQLNKEGKSICGDSFFMKADDKELICAVADGLGSGSLANESSAAIKDLV 63 + E+ ++T V+Q K+ + CGDS+F + E ICA+ADGLGSG LA ESS + ++ Sbjct: 1 MREHNKVETAVFQKAKKNRYYCGDSYFYTETENEYICALADGLGSGELAKESSEVVIGVI 60 Query: 64 ENYASEDVESIIERCNQAMKNKRGATASILKINFEQRQFTYCSVGNVRFILHSPSGESFY 123 ++ VE +I+ CNQ + KRGA IL+I+F Q+T+ S+GN+ + + +G Sbjct: 61 KDNIDATVEQLIKECNQKLSGKRGAVIGILRIDFRAHQYTFSSIGNIGVLAINENGRKKR 120 Query: 124 PLPISGYLSGKPQKYKTHTATYEKGSKFIIHTDGLNVPDIRSHLKKGQSVEEISNSLKMY 183 +P +GYL+G + +K T E ++FI+ +DG+ D+ + V ++ Y Sbjct: 121 NIPNTGYLAGYHRPFKVVTDGLEHAARFILFSDGVTDKDLSQWFLLNKDVYQVVQMFADY 180 Query: 184 TTS--RKDDLTYI 194 T S R DD T I Sbjct: 181 TDSVTRTDDTTLI 193 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 199 Length of database: 199 Length adjustment: 21 Effective length of query: 178 Effective length of database: 178 Effective search space: 31684 Effective search space used: 31684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory