Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_010531647.1 ON01_RS13770 threonine synthase
Query= curated2:Q58860 (405 letters) >NCBI__GCF_000224785.1:WP_010531647.1 Length = 403 Score = 227 bits (578), Expect = 5e-64 Identities = 127/374 (33%), Positives = 203/374 (54%), Gaps = 4/374 (1%) Query: 5 CIKCGKTYDVDEIIYTCECGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLPVKDE 64 C C K + C CGG L++ YD E + ++E L+ R +WRY E LPV++ Sbjct: 7 CKACAKATEFQLKQSKCTCGGTLQVEYDLERVGHTFTKESLKNRVTSMWRYKELLPVENP 66 Query: 65 SKIVSLCEGGTPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANELGVEV 124 I+SL EG TPL R + E++ +K L+VK E NPTGSFK RG + ++ AN G++ Sbjct: 67 QNIISLGEGWTPLVRMHRAEQKYPVKRLWVKREEQNPTGSFKARGFSSALSIANAYGIKK 126 Query: 125 VGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFDDALD 184 V S GN +++LAAY++ SG V +P+ L + + + YGA+ V G +A Sbjct: 127 VAVNSNGNAASALAAYASNSGMDSYVFVPKDCPGL-IIEECIQYGAQTYLVDGLIHNAGK 185 Query: 185 MVKQLAKEKLIYLLNSI-NPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISAIWK 243 +++ E+ Y + ++ P R EG+KT+ E+ +Q NW +PD +I P G + IW Sbjct: 186 VIEDGELEQDWYNVGTLKEPGRSEGKKTMGLELAEQFNWTLPDVIIYPTGGGSGVIGIWN 245 Query: 244 GFKEFEITGIID-ELPKMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGNPVN 302 + + G I+ +LP++ +Q +G +P+V+A ++ + T +R+ NP + Sbjct: 246 ALNQLKELGFIEGDLPRIVSVQEEGCQPLVDAIENGTAFNAQTQDISSNPTGMRVPNPPD 305 Query: 303 APKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGIIDR 362 L + SGG A AV++E+I EAQ L K+GI P A++ A L++ G I + Sbjct: 306 GELILSILRESGGTAVAVSEEDIKEAQTSLG-KQGISSSPEGAATWAAFTSLIDRGWIQQ 364 Query: 363 DERIVCITTGHGLK 376 D+ +V T H LK Sbjct: 365 DDEVVLFNTSHALK 378 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 403 Length adjustment: 31 Effective length of query: 374 Effective length of database: 372 Effective search space: 139128 Effective search space used: 139128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory