Align anthranilate synthase component II; EC 4.1.3.27 (characterized)
to candidate WP_010529591.1 ON01_RS03335 glutamine-hydrolyzing GMP synthase
Query= CharProtDB::CH_008350 (201 letters) >NCBI__GCF_000224785.1:WP_010529591.1 Length = 511 Score = 58.5 bits (140), Expect = 2e-13 Identities = 50/154 (32%), Positives = 67/154 (43%), Gaps = 9/154 (5%) Query: 46 IKSANYDKIIISPGPGHPADPAYFGVSADILKELGKTPPVLGICLGMQGMATVFGGEVVR 105 ++ N II+S GP D F +I ELG PVLGIC GMQ MA +GGEV + Sbjct: 43 VRQMNPTGIILSGGPHSVYDDNSFRCDPNIF-ELGI--PVLGICYGMQLMALHYGGEVSK 99 Query: 106 ANIAMHGKLSPIEHDGKGVFSGLTQGIEIMRYHSLVAKEISLPNDLEITARVSAGEGKGE 165 A +GK +F + H K I P + A Sbjct: 100 AANREYGKAEITLKQNPVLFGDTPDKQAVWMSHG--DKVIKTPESFQ----TDATSPSTP 153 Query: 166 IMGLRHKSLKIEGVQFHPESFGSEEGKCLLRNFI 199 I + + ++ GVQFHPE SE G LL++F+ Sbjct: 154 IAAMSNPESQLYGVQFHPEVRHSEYGHQLLKHFV 187 Lambda K H 0.319 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 511 Length adjustment: 27 Effective length of query: 174 Effective length of database: 484 Effective search space: 84216 Effective search space used: 84216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory