Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate WP_017548998.1 C792_RS0108255 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
Query= curated2:Q56002 (244 letters) >NCBI__GCF_000330705.1:WP_017548998.1 Length = 238 Score = 61.2 bits (147), Expect = 2e-14 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%) Query: 62 LLTGVEIHPGARLGQGIFIDHGMGVVIGETAIVGDYCLIYQGVTLGGTGKQSGKRHPTLA 121 ++ G I+ GA +G+G ID M +G A+ G + G L G + + Sbjct: 112 IMMGATINIGAIVGEGTMID--MNASLGGRAVTGKNVHVGAGAVLAGVIEPPSASPVVIE 169 Query: 122 NNVVVGAGAKVLGNIQIGENVRIGAGSVVLRDVPSDCTVVGIPGRVIYRS 171 ++V++GA A +L +++G + AG++V DVP+ V G P +VI +S Sbjct: 170 DDVLIGANAVILEGVRVGAGAIVAAGAIVTDDVPAGAVVAGTPAKVIKQS 219 Lambda K H 0.324 0.144 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 238 Length adjustment: 23 Effective length of query: 221 Effective length of database: 215 Effective search space: 47515 Effective search space used: 47515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory