Align Serine acetyltransferase; SAT; EC 2.3.1.30 (characterized)
to candidate WP_017549984.1 C792_RS0113455 serine O-acetyltransferase
Query= SwissProt::Q06750 (217 letters) >NCBI__GCF_000330705.1:WP_017549984.1 Length = 218 Score = 275 bits (704), Expect = 4e-79 Identities = 134/212 (63%), Positives = 163/212 (76%), Gaps = 2/212 (0%) Query: 3 FRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSR 62 FR + EDID V + DPAA++ EV TYSGLHA+W+H +AH LY++ F AR+ISQVSR Sbjct: 2 FRRINEDIDMVLELDPAAKNRLEVFFTYSGLHAVWSHLLAHRLYRKNFTTSARIISQVSR 61 Query: 63 FFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIK 122 F TGIEIHPGA +GRR FIDHGMG VIGETC IGNNVT++QGVTLGGTGKE+ KRHP + Sbjct: 62 FVTGIEIHPGAQVGRRLFIDHGMGTVIGETCRIGNNVTIYQGVTLGGTGKEEKKRHPDVD 121 Query: 123 DDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKKVR--RDL 180 D+ LIA GAKVLG+I + E SK+GA SVVL+DVP STVVGIPG VV Q G+KV+ RDL Sbjct: 122 DNVLIAAGAKVLGNIRIRENSKVGANSVVLYDVPKDSTVVGIPGHVVKQAGEKVKNARDL 181 Query: 181 NHQDLPDPVADRFKSLEQQILELKAELEDRKE 212 N DLPDP+ D LE +I + ++E+ + E Sbjct: 182 NQTDLPDPILDMILGLEDEIKDFRSEVRNEVE 213 Lambda K H 0.323 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 217 Length of database: 218 Length adjustment: 22 Effective length of query: 195 Effective length of database: 196 Effective search space: 38220 Effective search space used: 38220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_017549984.1 C792_RS0113455 (serine O-acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.2800565.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-77 245.4 0.7 1.6e-77 245.1 0.7 1.1 1 NCBI__GCF_000330705.1:WP_017549984.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000330705.1:WP_017549984.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 245.1 0.7 1.6e-77 1.6e-77 1 161 [. 5 165 .. 5 166 .. 0.99 Alignments for each domain: == domain 1 score: 245.1 bits; conditional E-value: 1.6e-77 TIGR01172 1 ikedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaakigrg 73 i+ed+++vle DPaa+++lev+++y+glha++++ lah+ly++++ + ar++s+++r++tg++ihP+a++gr+ NCBI__GCF_000330705.1:WP_017549984.1 5 INEDIDMVLELDPAAKNRLEVFFTYSGLHAVWSHLLAHRLYRKNFTTSARIISQVSRFVTGIEIHPGAQVGRR 77 689********************************************************************** PP TIGR01172 74 vliDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenakiGansvv 146 ++iDh++G viGet+ ig++v+iyqgvtLGgtgke+ kRhP+v ++v+i+agakvLGni++ en+k+Gansvv NCBI__GCF_000330705.1:WP_017549984.1 78 LFIDHGMGTVIGETCRIGNNVTIYQGVTLGGTGKEEKKRHPDVDDNVLIAAGAKVLGNIRIRENSKVGANSVV 150 ************************************************************************* PP TIGR01172 147 lkdvpaeatvvGvpa 161 l dvp+++tvvG+p+ NCBI__GCF_000330705.1:WP_017549984.1 151 LYDVPKDSTVVGIPG 165 **************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (218 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.03 // [ok]
This GapMind analysis is from Jul 26 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory